You Searched For: Ethyl-2,5-dibromothiazole-4-carboxylate

Catalog Number: (103007-440)

Supplier: Anaspec Inc

Description: This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA
MW:2272.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102999-386)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
MW: 4670.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-766)

Supplier: Anaspec Inc

Description: This is a peptide inhibitor of collagen fibrillar matrix assembly.
Sequence:SAGFDFSFLPQPPQEKAHDGGRYYRA
MW:2942.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This human Angiotensin I (Ang I) sequence also corresponds to horse, sheep, pig, and rat Ang I. Ang I is cleaved to Ang II by the angiotensin-converting enzyme (ACE). There is also evidence for non-angiotensin-converting enzyme-dependent conversion of Ang I to Ang II. Human chymase efficiently converts the 10-mer Ang I to the 8-mer hormone Ang II by splitting the Phe8-His9 bond in Ang I.
Sequence: DRVYIHPFHL
MW: 1296.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103010-916)

Supplier: Anaspec Inc

Description: An excellent amine-reactive FRET quencher paired with Trp or Tyr.

Catalog Number: (103010-512)

Supplier: Anaspec Inc

Description: Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Catalog Number: (103010-366)

Supplier: Anaspec Inc

Description: AMCA-X, SE is one of the most popular blue fluorescent tagging molecules. It is widely used to label antibodies, proteins and small drug molecules. AMCA-X succinimidyl ester contains a seven-atom aminohexanoyl spacer between the fluorophore and the reactive group.

Catalog Number: (102996-548)

Supplier: Anaspec Inc

Description: Enkephalins are pentapeptides involved in regulating nociception in the body. There are two enkephalin forms, one containing leucine and the other containing methionine ("met"). Both are products of the proenkephalin gene.
Sequence:YGGFL
MW:555.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-346)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at lysine 9 with a C-terminal GG linker followed by a biotinylated lysine. The monomethylation of histone H3 at lysine 9 is dynamically and sex-differentially regulated during meiotic prophase. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This is a pyroglutamic acid modified beta-amyloid 11-42 peptide. Pyroglutamic acid modified isoforms form the major isoforms with up to 20% of the total beta-amyloid species.
Sequence: Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3317.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103009-042)

Supplier: Anaspec Inc

Description: This peptide is histone H3 with acetylation at Lys4. It is biotinylated through a C-terminal GGK linker. This post-translationally modified histone peptide is found in humans, Tetrahymena thermophila, Schizosaccharomyces pombe , and mice. Acetylation at Lys4 is controlled by Mst1. This peptide acts as a chromodomain switch by weakening the interaction between Chp1 and the H3K9 methylated tail, thus facilitating binding of HP1 proteins. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ART-K(Ac)-QTARKSTGGKAPRKQLA-GGK(biotin)
MW:2765.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-548)

Supplier: Anaspec Inc

Description: Histone acetyltransferases (HATs) enzymes regulate the acetylation of histones and non-histone proteins

Catalog Number: (103010-240)

Supplier: Anaspec Inc

Description: MMP-9 (gelatinase-B, collagenase-IV) is involved in quite a few diseases such as a cancer, angiogenesis, alopecia and metastasis.

Catalog Number: (103007-710)

Supplier: Anaspec Inc

Description: This peptide is a poly-gamma-D-glutamic acid (DPGA)10 construct that relates to the sequence of the Bacillus anthracis capsule which is composed of gamma DPGA. gamma DPGA is an essential virulence factor of B. anthracis. The capsule inhibits innate host defense through its antiphagocytic action. gamma DPGA is a poor immunogen, but when bound to a carrier protein, it elicits serum antibodies.

Supplier: Anaspec Inc

Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.

Catalog Number: (103008-434)

Supplier: Anaspec Inc

Description: This is a 5-FAM-labeled Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor. Livin prevents apoptosis and sensitizes Livin-expressing cells to chemotherapy. This peptide has the potential to be used as a therapeutic agent in cancer treatment.
Sequence:AVPIAQKSEK-K(5-FAM)-NH2
MW:1555.8 Da
% peak area by HPLC:95
Storage condition:-20° C