You Searched For: Anaspec Inc

Catalog Number: (103009-174)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (1-24) acetylated at Lys14, Lys18, and Lys23, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-A-GGK(Biotin)
MW:3149.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-918)

Supplier: Anaspec Inc

Description: This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-024)

Supplier: Anaspec Inc

Description: The peptide 2-furoyl-LIGRLO-NH2 showed higher potency and receptor selectivity for in vitro assays than other PAR-2-activating peptides. 2-Furoyl-LIGRLO-NH2 peptide was equally or more potent than SLIGRL-NH2 for increasing intracellular calcium in cultured human and rat PAR-2-expressing cells and significantly more potent than SLIGRL-NH2 in assays of tissue PAR-2 activity.
Sequence: 2 - Furoyl - LIGRLO - NH2
MW: 778 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103011-276)

Supplier: Anaspec Inc

Description: 3,3'-Dipropylthiadicarbocyanine iodide [DiSC3(5)] ≥95% (by HPLC)

Catalog Number: (103007-254)

Supplier: Anaspec Inc

Description: This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-200)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-150)

Supplier: Anaspec Inc

Description: EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-606)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-442)

Supplier: Anaspec Inc

Description: This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103008-518)

Supplier: Anaspec Inc

Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-446)

Supplier: Anaspec Inc

Description: This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Catalog Number: (102996-368)

Supplier: Anaspec Inc

Description: This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-048)

Supplier: Anaspec Inc

Description: This peptide is Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)
MW:3024.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-036)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36.
Sequence:STGGV-K(Me1)-KPHRY
MW:1243.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-032)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27.
Sequence:KAAR-K(Me2)-SAPATGG
MW:1142.3 Da
% peak area by HPLC:95
Storage condition:-20° C