You Searched For: Anaspec Inc

Catalog Number: (103010-440)

Supplier: Anaspec Inc

Description: B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. SMCC activated B-PE is chemically modified with SMCC. SMCC reacts with the primary amine on B-PE and introduces maleimide groups to B-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of B-PE with proteins. Its primary absorption peak is at 545 nm with secondary peak at 563 nm. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE conjugates have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Catalog Number: (103009-506)

Supplier: Anaspec Inc

Description: This is histone H3 (1-21) dimethylated at Lys9. Methylation of Lys 9 is associated with transcriptionally silent chromatin. Histone H3 mono- and dimethylated at Lys 9 localize specifically to silent domains within euchromatin while histone H3 trimethylated at this residue localizes to pericentric heterochromatin.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA
MW:2282.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-478)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (1-50) biotinylated through a C-terminal GGK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
MW:5809.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103011-116)

Supplier: Anaspec Inc

Description: Phthalaldehyde 95 HPLC_ASSAY_METHOD, Ultra Pure Grade

Catalog Number: (103011-146)

Supplier: Anaspec Inc

Description: Biomarker for cell cycle and cell proliferation

Catalog Number: (103011-196)

Supplier: Anaspec Inc

Description: Cell culture reagent for dissolving AM esters.

Catalog Number: (103006-924)

Supplier: Anaspec Inc

Description: This is a 5-FAM-labeled Bid BH3 peptide. Bid is a pro-apoptotic member of the 'BH3-only' subset of the BCL-2 family proteins that constitute a critical control point in apoptosis. Bid interconnects extrinsic pathway TNFR1 and Fas death signals to the mitochondrial amplification of the intrinsic pathway. The references listed below belong to the unlabeled Bid BH3.
Sequence:5-FAM-EDIIRNIARHLAQVGDSMDR
MW:2667.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-914)

Supplier: Anaspec Inc

Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-076)

Supplier: Anaspec Inc

Description: This FRET peptide is a specific substrate for renin. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte® 520 Renin Assay Kit, cat # AS-72040 from AnaSpec.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103007-294)

Supplier: Anaspec Inc

Description: A potent inhibitor specific for ACE2. It has a Ki of 2.8 nM.
Sequence:Ac-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
MW:3076.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103007-222)

Supplier: Anaspec Inc

Description: LyP-1 recognizes lymphatics and tumor cells in certain tumors, but not lymphatics in normal tissues. Screening on breast carcinoma xenografts shows positive to cyclic 9-amino-acid peptide, LyP-1. The LyP-1 also recognizes an osteosarcoma xenograft, and spontaneous prostate and breast cancers in transgenic mice. LyP-1 peptide is detected in tumor structures that are positive for several lymphatic endothelial markers and negative for blood vessel markers. LyP-1 accumulates in the nuclei of the putative lymphatic cells, and in the nuclei of tumor cells.
Sequence:CGNKRTRGC (S-S Bonded)
MW:992.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-242)

Supplier: Anaspec Inc

Description: The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103007-230)

Supplier: Anaspec Inc

Description: This peptide is the e-PKC specific activator, it also activates MARCKS phosphorylation in wild type cells, and has no effect on MARCKS phosphorylation in the cells derived from knockout mice.
Sequence:HDAPIGYD
MW:886.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.
Sequence:KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW:4003.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102999-774)

Supplier: Anaspec Inc

Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:Biotin-YGGFLRRIRPKLKWDNQ
MW:2373.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-290)

Supplier: Anaspec Inc

Description: The SensoLyte® Plus 520 MMP-9 Assay Kit is designed for specifically detecting MMP-9 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-9 monoclonal antibody is used in combination with a MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-9-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.