You Searched For: Anaspec Inc

Catalog Number: (103007-188)

Supplier: Anaspec Inc

Description: This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-576)

Supplier: Anaspec Inc

Description: This peptide is a fragment of the human aquaporin-2 (AQP2) phosphorylated at Ser261. Protein phosphorylation plays a key role in vasopressin signaling in renal-collecting duct. Phosphorylation at several AQP2 residues including Ser256 and Ser261, is altered in response to vasopressin. It is possible that both sites are involved in vasopressin-dependent AQP2 trafficking.
Sequence: RQSVELH-pS-PQSLPR
MW: 1713.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4233.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Catalog Number: (102999-348)

Supplier: Anaspec Inc

Description: Anionic interaction of Aß(1-11) with Factor XII is suspected to cause the massive activation of the C4 (Complement 4) system in cerebrospinal fluid of Alzheimer’s disease patients.
Sequence: DAEFRHDSGYE
Molecular Weight: 1325.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-520)

Supplier: Anaspec Inc

Description: Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Catalog Number: (103007-304)

Supplier: Anaspec Inc

Description: The GRGDS peptide contains the amino acid sequence Arg-Gly-Asp (RGD), which has been implicated as a recognition site in interactions between extracellular matrix (ECM) molecules and cell membrane receptors. RGD-containing synthetic peptides are known to inhibit attachment of endothelial cells to substrates. GRGDS peptide inhibits angiogenesis in serum-free collagen gel culture. This synthetic peptide mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer.
Sequence:Biotin-LC-GRGDS
MW:830 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-794)

Supplier: Anaspec Inc

Description: 6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.

Catalog Number: (103010-504)

Supplier: Anaspec Inc

Description: The calpains are a family of intracellular Ca²⁺ dependent cysteine proteases

Catalog Number: (103009-620)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 1-25. It is acetylated at lysine 5/8/12/16.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
MW:2373.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-988)

Supplier: Anaspec Inc

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown. Cathepsin D is involved in the pathogenesis of several diseases such as breast cancer and Alzheimer disease. Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in the protein degradation, the generation of bioactive proteins, and antigen processing. Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms.
An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus). The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.
Sequence:Mca-GKPILFFRLK(Dnp)-r-NH2
MW:1756.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 3355.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-518)

Supplier: Anaspec Inc

Description: This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103003-360)

Supplier: Anaspec Inc

Description: α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103007-818)

Supplier: Anaspec Inc

Description: This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.
Sequence:TKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
MW:3019.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: CGRP is a 37-amino acid neuropeptide produced by tissue specific processing of the calcitonin gene and is the major product in neural tissues.
Sequence:ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
MW:3789.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C