You Searched For: Anaspec Inc

Catalog Number: (103006-882)

Supplier: Anaspec Inc

Description: This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-886)

Supplier: Anaspec Inc

Description: This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-368)

Supplier: Anaspec Inc

Description: This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-022)

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103009-918)

Supplier: Anaspec Inc

Description: This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This 14-residue peptide toxin from the wasp venom is originally found as a histamine releaser from mast cells. It induces mitochondrial membrane permeabilization via a CsA-inhibitable mechanism.
Sequence:INLKALAALAKKIL-NH2
MW:1478.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-474)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (1-35).
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
MW:3551.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-200)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (102999-350)

Supplier: Anaspec Inc

Description: This is the 22-35 fragment of b-Amyloid peptide (human, mouse, rat).
Sequence: EDVGSNKGAIIGLM
Molecular Weight: 1403.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-122)

Supplier: Anaspec Inc

Description: Conjugates of calf intestinal alkaline phosphatase are extensively used as secondary detection reagents in ELISAs, immunohistochemical techniques and Northern, Southern and Western blot analyses

Catalog Number: (103010-024)

Supplier: Anaspec Inc

Description: The peptide 2-furoyl-LIGRLO-NH2 showed higher potency and receptor selectivity for in vitro assays than other PAR-2-activating peptides. 2-Furoyl-LIGRLO-NH2 peptide was equally or more potent than SLIGRL-NH2 for increasing intracellular calcium in cultured human and rat PAR-2-expressing cells and significantly more potent than SLIGRL-NH2 in assays of tissue PAR-2 activity.
Sequence: 2 - Furoyl - LIGRLO - NH2
MW: 778 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103008-036)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36.
Sequence:STGGV-K(Me1)-KPHRY
MW:1243.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-230)

Supplier: Anaspec Inc

Description: MMP-1 (interstitial collagenase, fibroblast collagenase) is an extracellular protease

Catalog Number: (103003-342)

Supplier: Anaspec Inc

Description: This thrombin receptor agonist peptide is a PAR 1 antagonist peptide.
Sequence:FLLRN
MW:661.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103009-174)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (1-24) acetylated at Lys14, Lys18, and Lys23, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-A-GGK(Biotin)
MW:3149.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-900)

Supplier: Anaspec Inc

Description: DEAC, SE is an excellent blue fluorescent building block for labeling amine-containing biomolecules.