You Searched For: Anaspec Inc

Supplier: Anaspec Inc

Description: Although the mixed TAMRA isomers are predominantly used for labeling proteins, the single isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes. 5-TAMRA is more often used than 6-TAMRA for labeling peptides and proteins. 6-TAMRA is predominately used for labeling nucleotides and sequencing nucleic acids.

Catalog Number: (103010-824)

Supplier: Anaspec Inc

Description: 6-ROX, SE is the other purified single isomer of 5(6)-ROX, SE. It appears that 5-ROX is more often used than 6-ROX for labeling peptides and proteins. 6-ROX is predominately used for labeling nucleotides and sequencing nucleic acids.

Catalog Number: (103009-696)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 1-21 with a C-terminal GG linker followed by a biotinylated lysine. Arginine 3 is dimethylated symmetrically.
Sequence:Ac-SG-R(me2s)-GKGGKGLGKGGAKRHRKV-GGK(biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This 13 amino acid peptide was first isolated from bovine hypothalamus and was named from its neuronal localization. It was detected in the central nervous system (CNS) and peripheral tissues mainly in the gastrointestinal tract. This bioactive form of neurotensin post-translationally modified at a Glu residue was isolated from porcine intestine.
Sequence:Pyr-LYENKPRRPYIL
MW:1673 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Somatostatin [SST, GHIH (growth hormone-inhibiting hormone) or SRIF (somatotropin release-inhibiting factor)] is a cyclic peptide hormone existing as two isoforms and produced in the pancreas islet, GI tract and the central nervous system. Tetradecapeptide Somatostatin-14 (SRIF-14, the originally identified somatostatin) and the 28-amino acid Somatostatin-28 (SRIF-28) have similar biological activities but differ in their potency. Somatostatins regulate the endocrine system: they inhibit the release of growth hormone in contrast to Growth Hormone Factor (GRF), which stimulates the release of growth hormone. They also inhibit the release of prolactin and thyrotropin, peptide hormones from the pituitary gland and glucagon and insulin from the pancreas. They control the secretion of gut hormones and function as neurotransmitters.
Sequence: AGCKNFFWKTFTSC (Disulfide bridge: 3-14)
MW: 1637.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (102996-474)

Supplier: Anaspec Inc

Description: c-Myc, the product of the c-myc proto-oncogene, is a helix-loop-helix leucine zipper phosphoprotein that regulates gene transcription in cell proliferation, cell differentiation and apoptosis. This peptide is a human c-myc epitope.

Catalog Number: (102996-446)

Supplier: Anaspec Inc

Description: This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm.
Sequence:vLR-AFC
MW:597.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-438)

Supplier: Anaspec Inc

Description: This is a fluorescent peptide, Abs/Em=380/500. It is a substrate for dipeptidyl peptidase IV (DPP IV) and Xaa-Pro dipeptidase.
Sequence:AP-AFC
MW:397.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-430)

Supplier: Anaspec Inc

Description: This is a fluorescent dipeptidylaminopeptidase IV substrate, Abs/Em=353/442 nm.
Sequence:GP-AMC
MW:329.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-080)

Supplier: Anaspec Inc

Description: The synthetic peptide (Tat-Glur23Y) contains tyrosine residues that blocks phosphorylation of alpha-amino-3-hydroxy-5-methyl-isoxazole-4-propionic acid (AMPA) receptor endocytosis. Previous research shows that Tat-Glur23Y blocks regulated AMPA and thereby prevents long-term depression (LTD) in structures such as the nucleus accumbens and dorsal hippocampus.
Sequence: YGRKKRRQRRRYKEGYNVYG
MW: 2634 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 21 to 44 tri-methylated at Lys-27 with an addidtional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-022)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9.
Sequence:TKQTAR-K(Me1)-STGGKAPR
MW:1600.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-040)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 31 to 41 tri-methylated at Lys-36.
Sequence:STGGV-K(Me3)-KPHRY
MW:1271.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-064)

Supplier: Anaspec Inc

Description: T4 peptide (SIITFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIITFEKL
MW: 950.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21 mono-methylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)
MW:2737.2 Da
% peak area by HPLC:95
Storage condition:-20° C