You Searched For: Anaspec Inc


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103006-384)
Supplier: Anaspec Inc
Description: This sequence is from the C-terminal sequence of the P and V proteins of Simian Virus 5.
Sequence:GKPIPNPLLGLDST
MW:1421.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-280)
Supplier: Anaspec Inc
Description: GALA is a 30 amino acid synthetic peptide with a glutamic acid-alanine-leucine-alanine (EALA) repeat. It also contains a histidine and tryptophan residue as spectroscopic probes. This peptide was designed to explore how viral fusion protein sequences interact with membranes. It was used to study the importance of the helix length, hydrophobicity, and hydrophobic moment on the formation, structure, and function of ion channels. The membrane-interacting properties of GALA have been extensively documented. Investigations with analogs of cytotoxic peptides clarify the importance of peptide charge and the role of particular amino acids or arrays of amino acids in the conformation, membrane-binding affinity, and pore-forming abilities of these toxins.
Sequence:WEAALAEALAEALAEHLAEALAEALEALAA
MW:3032.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: This peptide is angiontensin I (Ang I) with valine and isoleucine universally labeled with 13C and N. Ang I is a precursor to Ang II, which has been implicated in cardiovascular functions, cell proliferation, fibrosis, and apoptosis. The 10-mer Ang I peptide is converted to Ang II through the cleavage of the Phe8-His9 bond of Ang I by angiotensin-converting enzyme (ACE) or human chymase.

Catalog Number: (103010-418)
Supplier: Anaspec Inc
Description: Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown


Catalog Number: (103011-162)
Supplier: Anaspec Inc
Description: Acrylodan is a thiol-reactive dye whose fluorescence is very sensitive to conformational changes, and is well-adapted to protein structural analyses.


Catalog Number: (103006-078)
Supplier: Anaspec Inc
Description: A control peptide for LSKL (inhibitor of thrombospondin).
Sequence:SLLK - NH2
MW:458.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103007-328)
Supplier: Anaspec Inc
Description: C18G is a synthetic α-helical peptide derived from human platelet factor IV. This peptide was found to be antibacterial and is active against Salmonella.
Sequence:ALYKKLLKKLLKSAKKLG
MW:2043.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-1 (collagenase-1) is involved in tumor development and metastasis and rheumatoid arthritis. It is proposed as a therapeutic target for these diseases. MMP-1 digests a broad range of substrates, including α-1 antitrypsin, myelin basic protein, collagen I, II, III, VII, VIII, casein, gelatin, and others

Catalog Number: (103009-746)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-166)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103007-758)
Supplier: Anaspec Inc
Description: This is a FAM (Abs/Em = 492/518 nm) labeled histone 3 (H3) amino acid residues 1 to 21 with lysine 4 methylated.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2868.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103011-296)
Supplier: Anaspec Inc
Description: This substrate is soluble bovine neck ligament elastin that is heavily labeled with FITC such that the conjugate's fluorescence is quenched. Upon digestion by elastase or other proteases, the fluorescence is recovered. Digestion products from the elastin substrate have absorption maxima at ~492 nm and fluorescence emission maxima at ~515 nm. Because the assay is continuous, kinetics data can be obtained easily. The elastin derivative is also digested by proteases other than elastase.


Catalog Number: (103010-678)
Supplier: Anaspec Inc
Description: Insulin degrading enzyme (IDE) is considered a physiological and pathological relevant enzyme


Catalog Number: (103010-694)
Supplier: Anaspec Inc
Description: Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development


Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103010-798)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 647 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dyes.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
49 - 64 of 1,910
no targeter for Bottom