You Searched For: Anaspec Inc

Catalog Number: (103006-888)

Supplier: Anaspec Inc

Description: Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103006-812)

Supplier: Anaspec Inc

Description: This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-882)

Supplier: Anaspec Inc

Description: This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-216)

Supplier: Anaspec Inc

Description: This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-252)

Supplier: Anaspec Inc

Description: A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-546)

Supplier: Anaspec Inc

Description: This is a biotinylated fragment of the human, mouse, rat ß-amyloid (15-25).
Sequence: Biotin-LC-QKLVFFAEDVG
Molecular Weight: 1591.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-518)

Supplier: Anaspec Inc

Description: This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103007-588)

Supplier: Anaspec Inc

Description: This is amino acids 54 to 65 fragment of sulfated hirudin, a 65-residue peptide. Hirudin is found in the saliva of the leech Hirudo medicinalis. This sulfated peptide binds tightly to anion-binding exosite I of thrombin, but does not inhibit hydrolysis of synthetic peptide substrates.
Sequence:Ac-GDFEEIPEE-Y(SO3H)-LQ
MW:1590.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103007-532)

Supplier: Anaspec Inc

Description: A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.
Sequence:KKKYPGGSTPVSSANMM
MW:1783.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 3355.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-842)

Supplier: Anaspec Inc

Description: This peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR) is biotinylated on the N-terminus.
Sequence:Biotin-GEEPLYWSFPAKKK-NH2
MW:1905.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-818)

Supplier: Anaspec Inc

Description: This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.
Sequence:TKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
MW:3019.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-838)

Supplier: Anaspec Inc

Description: This is peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR).
Sequence:GEEPLYWSFPAKKK-NH2
MW:1678 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-442)

Supplier: Anaspec Inc

Description: This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103008-426)

Supplier: Anaspec Inc

Description: This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-g). B8R binding to IFN-g neutralizes its antiviral activity.
Sequence:TSYKFESV
MW:960.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-438)

Supplier: Anaspec Inc

Description: This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C