You Searched For: Anaspec Inc

Catalog Number: (103006-354)

Supplier: Anaspec Inc

Description: In one study where this peptide was labeled with 125I, it was found to bind specifically and with high affinity to alpha-v/beta-3 receptors on neovascular blood vessel sections of different major human cancers. The integrin alpha(IIb)beta(3)-specific cyclic hexapeptide contains an Arg-Gly-Asp (RGD) sequence.
Sequence:Cyclo(-RGDfK)
MW:603.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-362)

Supplier: Anaspec Inc

Description: This kit contains 6 individually-packed phosphopeptides at 10 ug each. These phosphopeptides can be used for the characterization of affinity purified phosphorylated peptides in liquid chromatography / mass spectrometry. FQ-pS-EEQQQTEDELQDK MW: 2062.0 (Bovine ß-Casein, monophospho cat# 61146, $120/mg) DLDVPIPGRFDRRV-pS-VAAE MW: 2192.4 (PKA Regulatory Subunit II Substrate, cat# 24516, $295/mg) KRP-pS-QRHGSKY-NH2 MW: 1422.5 (UOM9, Phosphorylated PKC Substrate-3, cat# 20294, $175/mg) SFVLNPTNIGM-pS-KSSQGHVTK MW: 2312.6 (DAM1 [221-241] peptide, cat# 61242, $180/mg) TRDIYETDpYYRK MW: 1702.8 (Kinase Domain of Insulin Receptor, cat# 20274 $195/mg) TRDIpYETDpYpYRK MW: 1862.8 (Kinase Domain of Insulin Receptor, cat# 20272 $240/mg)
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.
Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103004-226)

Supplier: Anaspec Inc

Description: This serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice.
Sequence: HSLGKWLGHPDKF
MW: 1521.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103004-216)

Supplier: Anaspec Inc

Description: HLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142).
Sequence: ATIGTAMYK
MW: 955.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103006-078)

Supplier: Anaspec Inc

Description: A control peptide for LSKL (inhibitor of thrombospondin).
Sequence:SLLK - NH2
MW:458.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (102999-858)

Supplier: Anaspec Inc

Description: A number of Aß fragments including Aß (10-20) enhances aggregation of Aß (1-40). All the Aß peptides that enhance aggregation contain either residues 17 to 20 or 30 to 35, indicating the importance of these regions for promoting aggregation of full-length Aß.
Sequence: YEVHHQKLVFF
Molecular Weight: 1446.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: In Alheimer's Disease brains, plaques contain amino-terminal truncated beta-Amyloid peptides including the alpha secretase-generated p3 fragments, beta-Amyloid 17-40 and 17-42. They were shown to induce pro-inflammatory cytokine and chemokine production in vitro and in vivo.

Catalog Number: (102999-378)

Supplier: Anaspec Inc

Description: This sequence corresponds to amino acids 3-13 from murine MBP. MBP induces immune reactivity in multiple sclerosis (MS), a chronic inflammatory demyelinating disease of the CNS. MBP (3-13) is a substrate for Protein Kinase C.
Sequence:QKRPSQRSKYL
MW:1390.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102999-360)

Supplier: Anaspec Inc

Description: PET (Positron Emission Tomography) imaging of [Lys3]-bombesin is able to detect gastrin-releasing peptide receptor (GRPR) positive prostate cancer. An immunoconjugate of [Lys3]-bombesin and corresponding monoclonal antibody can specifically induce (CD64)-dependent monocyte and neutrophil-mediated lysis of small cell carcinoma.
Sequence:Pyr-QKLGNQWAVGHLM-NH2
MW:1591.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-740)

Supplier: Anaspec Inc

Description: A hypotensive and diuretic peptide. Originally isolated from the skin of the frog, Phyllomedusa sauvagei. It affects diuresis in the cardiovascular system and causes the release of ACTH and endorphins.
Sequence:Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2
MW:4599.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103005-318)

Supplier: Anaspec Inc

Description: This is an N-terminally biotinylated peptide, with a phosphorylated Thr97. The sequence APRTPGGRR contains a native sequence derived from bovine myelin basic protein amino acids 95-98 (PRTP). The rest of the sequence is not derived from a native sequence, but is a synthetic construct. APRTPGGRR is specific for MAP kinases: p44MAPK [extracellular signal-regulated kinase 1 (ERK1)] and p42MAPK (ERK2). It contains the consensus sequence Pro-X-(Ser/Thr)-Pro that is recognized by MAP kinase. APRTPGGRR is the most efficient substrate for phosphorylation reaction by ERK and is phosphorylated by kinases on threonine 97 and can also be phosphorylated by MAPK p38.
Sequence:Biotin-APR-pT-PGGRR
MW:1273.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-320)

Supplier: Anaspec Inc

Description: This is amino acids 17 to 26 fragment of p53, fluorescent labeled through an LC spacer. This peptide is the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that come into contact with the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development, FITC (Abs/Em=493 nm/517 nm)..
Sequence:FITC-LC-ETFSDLWKLL-NH2
MW:1753.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-312)

Supplier: Anaspec Inc

Description: Melittin, a 26-residue bee venom peptide, is known to induce murine antibodies specific for its hydrophilic C-terminus of residues 20 to 26 and T-cell responses specific for its hydrophobic mid-region (residue 11 to 19). This peptide is an anti-inflammatory agent, it inhibits the lyme disease spirochete.
Sequence:GIGAVLKVLTTGLPALISWIKRKRQQ-NH2
MW:2846.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-328)

Supplier: Anaspec Inc

Description: C18G is a synthetic α-helical peptide derived from human platelet factor IV. This peptide was found to be antibacterial and is active against Salmonella.
Sequence:ALYKKLLKKLLKSAKKLG
MW:2043.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103007-390)

Supplier: Anaspec Inc

Description: This peptide is amino acids 276 to 286 fragment of the lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), also known as GP276. It is the H-2Db restricted epitope. LCMV has been routinely exploited for the study of adaptive immune responses to viral infection. Fifty to seventy percent of CD8 T cells at the peak of LCMV infection appear to be specific for five LCMV-derived epitopes including GP276.
Sequence:SGVENPGGYCL
MW:1095.2 Da
% peak area by HPLC:95
Storage condition:-20° C