You Searched For: Anaspec Inc

Catalog Number: (103006-428)

Supplier: Anaspec Inc

Description: This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. The N-terminus is rendered free for applications requiring certain conjugation reactions with a free N-terminal end, and a linker GGG is placed at the C-terminal end, and the peptide has been synthesized with the C(Npys) group. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: YGRKKRRQRRRGGG-C(Npys)-NH2
MW: 1987.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103007-792)

Supplier: Anaspec Inc

Description: Genetic transformation in Streptococcus pneumoniae, Streptococcus mitis and Streptococcus oralis is regulated by secreted peptide pheromones named the competence-stimulating peptide (CSP). Different strains and species of these bacteria produce CSP with different primary sequence. They are termed pheromones CSP-1 (EMRLSKFFRDFILQRKK), CSP-2 (EMRISRIILDFLFLRKK), CSP-153 (DKRLPYFFKHLFSNRTK), CSP-612 (ESRLSRLLRDFIFQIKQ), CSP-676 (ERRIPDVIRSLLFQKRK), and CSP-12261 (EIRQTHNIFFNFFKRR).
Sequence:EMRISRIILDFLFLRKK
MW:2178.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-764)

Supplier: Anaspec Inc

Description: This peptide is Staphylococcal Enterotoxin B domain (SEB) amino acid residue 163-172. This peptide sequence is highly conserved. It has been shown to inhibit transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1.
Sequence:KKKVTAQELD
MW:1159.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-798)

Supplier: Anaspec Inc

Description: Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 7-amino-4-methylcoumarin (AMC) labeled peptide is widely used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases. Cleavage of this AMC peptide by the enzymes generates strongly fluorescent AMC that is monitored fluorimetrically at Abs/Em=353/442 nm.
Sequence:Suc-LLVY-AMC
MW:763.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This peptide is a histone H3 trimethylated at lysine 4 and is associated with transcription, specifically marking the transcription start site of actively transcribed genes. This peptide can be demethylated by Jumonji AT-rich interactive domanin 1 (JARID1) or by lysine demethylase 5 (KDM5) family of lysine demethylases.
Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA
MW: 2296.6 Da
% peak area by HPLC: 95
Storage condition: -20 °C

Catalog Number: (103005-964)

Supplier: Anaspec Inc

Description: Cleavage of this FRET substrate generates the fluorescent Mca signal that is monitored fluorimetrically at 393 nm, with excitation at 325 nm. A highly fluorescent substrate for caspase 1.
Sequence: Mca-YVADAPK(Dnp)
MW: 1145.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103005-942)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
MW:1913.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4412.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-002)

Supplier: Anaspec Inc

Description: An ACE-2 (Angiotensin I-converting enzyme 2) fluorescent substrate. Complete hydrolysis of 0.04 mM results in a 300-fold fluorescence increase over background. Max Abs/Em=325/393 nm upon cleavage of substrate.
Sequence: Mca-APK(Dnp)
MW: 696.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103005-974)

Supplier: Anaspec Inc

Description: This peptide, with the diaminopimelic acid coupled to the gamma-carboxylic acid of the D-isomer of Glu, stimulates Nod1-dependent apoptosis.
Sequence:A-(g-e)-DAP
MW:390.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103005-970)

Supplier: Anaspec Inc

Description: A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-284)

Supplier: Anaspec Inc

Description: This fluorogenic HIV-1 protease substrate contains the FRET pair HiLyte488 (fluorophore) and QXL520 (quencher), and a γ-Abu spacer. This FRET substrate is cleaved by the HIV-1 protease to generate fuorescence (Ex = 490nm; Em = 520nm).
Sequence:QXL™520-GABA-SQNYPIVQ-K(HiLyte Fluor™ 488)-NH2
MW:2008.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Catalog Number: (103009-388)

Supplier: Anaspec Inc

Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103009-404)

Supplier: Anaspec Inc

Description: This heparin-binding peptide is derived from vitronectin (367-378). Vitronectin is a glycoprotein found in monomer form in the blood and oligomer form in the extraceullular matrix. This peptide has been shown to promote the adhesion and undifferentiated growth of human pluripotent stem cells.
Sequence:GKKQRFRHRNRKG
MW:1668 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-386)

Supplier: Anaspec Inc

Description: This peptide is H2-Kd-restricted enhanced green fluorescent protein (EGFP)-derived peptide (200-208) and represents a CD8 T cell epitope. Immunization with this peptide stimulates IFNg production, thus making this peptide a model tumor antigen for the experimental development of antigen-specific vaccines against cancer.
Sequence:HYLSTQSAL
MW:1019.1 Da
% peak area by HPLC:95
Storage condition:-20° C