You Searched For: Anaspec Inc

Catalog Number: (103011-316)

Supplier: Anaspec Inc

Description: Chromogenic N-acetylgalactosaminidase substrate

Catalog Number: (103010-962)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor594 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.

Catalog Number: (103011-046)

Supplier: Anaspec Inc

Description: DABCYL acid is the abbreviation of 4-(dimethylaminoazo)benzene-4-carboxylic acid. In some literature, DABSYL (4-dimethylaminoazobenzene-4'-sulfonyl chloride) is misused as ‘DABCYL’. DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL dyes are often paired with EDANS in FRET-based fluorescent probes.

Catalog Number: (103011-052)

Supplier: Anaspec Inc

Description: Although DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates, its extremely high hydrophobicity and resultant poor water solubility have limited its use in the development of sensitive fluorogenic FRET probes. DABCYL Plus™ is developed to address this limitation. DABCYL Plus™ retains spectral properties similar to those of DABCYL. This feature enables researchers to keep all assay settings similar to those of DABCYL’s probes. In addition, DABCYL Plus™ has much greater water solubility than DABCYL. We have used DABCYL Plus™ to develop various protease substrates. In some cases, it has demonstrated greatly improved enzyme performance.

Catalog Number: (103011-116)

Supplier: Anaspec Inc

Description: Phthalaldehyde ≥95% (by HPLC), Ultra Pure Grade

Catalog Number: (103011-084)

Supplier: Anaspec Inc

Description: B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. Its primary absorption peak is at 545 nm with a secondary peak at 563 nm. B-PE consists of a, b and g subunits and is present as (ab)6g. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE labeled streptavidin, primary and secondary antibodies have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Catalog Number: (103011-332)

Supplier: Anaspec Inc

Description: Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavag

Catalog Number: (103011-376)

Supplier: Anaspec Inc

Description: Environment-sensitive dye for studying membranes and structures of proteins.

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103009-612)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-970)

Supplier: Anaspec Inc

Description: Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Penetratin-Arg is the same as Penetratin except that Lysine residues were substituted with Arginines. It forms an alpha-helix structure in lipid environment and can permeate cell membrane at low micromolar concentration without significantly affecting membrane. CPP can be conjugated with large molecules and used as a drug delivery vehicle. R
Sequence:RQIRIWFQNRRMRWRR
MW:2358.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-890)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-25) with acetylation at Lys5. It is biotinylated through a C-terminal GSGSK linker. Acetylation at Lys5 plays a role in histone deposition and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-404)

Supplier: Anaspec Inc

Description: This heparin-binding peptide is derived from vitronectin (367-378). Vitronectin is a glycoprotein found in monomer form in the blood and oligomer form in the extraceullular matrix. This peptide has been shown to promote the adhesion and undifferentiated growth of human pluripotent stem cells.
Sequence:GKKQRFRHRNRKG
MW:1668 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102997-138)

Supplier: Anaspec Inc

Description: HLA A2-restricted epitope from influenza matrix protein (58-66).
Sequence: GILGFVFTL
MW: 966.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103010-030)

Supplier: Anaspec Inc

Description: This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation.
Sequence: trans - Cinnamoyl - YPGKF - NH2
MW: 739.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103008-598)

Supplier: Anaspec Inc

Description: This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.
Sequence:Dabcyl-LNKRLLHETQ-EDANS
MW:1751.1 Da
% peak area by HPLC:95
Storage condition:-20° C