You Searched For: Anaspec Inc


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103011-142)
Supplier: Anaspec Inc
Description: Cell-permeant DNA minor groove binding dye


Catalog Number: (103010-948)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 750 amine is a carbonyl-reactive fluorescent labeling dye. Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 amine is the longest-wavelength carbonyl-reactive HiLyte™ Fluor dye currently available.


Catalog Number: (103010-632)
Supplier: Anaspec Inc
Description: The recombinant human Sirtuin 1 (GenBank Accession #: NM_012238) with 193- 741 amino acids and GST tag at its N-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 87.2 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.


Catalog Number: (103010-186)
Supplier: Anaspec Inc
Description: Aggrecanases belong to ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases


Supplier: Anaspec Inc
Description: This peptide is beta-amyloid N-terminally truncated to obtain 5-42 peptide.
Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4051.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-600)
Supplier: Anaspec Inc
Description: This is a cell adhesive peptide (RGDC), capable of binding to surface Zr alkoxide complexes through (maleimido) alkylcarboxylate intermediates. This peptide may be used to stimulate human osteoblast attachment.
Sequence:RGDC
MW:449.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:5-FAM-KRREILSRRPSYR
MW:2075.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-562)
Supplier: Anaspec Inc
Description: This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103009-976)
Supplier: Anaspec Inc
Description: Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468
Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103005-948)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide contains 5-FAM only and is similar to the proteolytic product of the 520 MMP FRET substrates. It can be used to set up the fluorescence standard curve. Abs/Em = 494/521 nm.
Sequence:5-FAM-PL
MW:586.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-544)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-21), acetylated at lysine 12. The N-terminus contains a C-terminus GG linker followed by a biotinylated lysine. The acetylation of histone H4 plays a crucial role in structural changes that amplifies the binding of transcription factors to their recognition sites within the nucleosomes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-586)
Supplier: Anaspec Inc
Description: This is a type I signal peptidase (SPase1) substrate peptide labeled with EDANS/ DABCYL FRET pair, and contains a crucial cleavage site derived from the C-terminal region of the Staphylococcus epidermidis pre-SceD protein. Abs/Em = 340/490 nm.
Sequence:Dabcyl-AGHDAHASET-Edans
MW:1494.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-980)
Supplier: Anaspec Inc
Description: Erktide is a peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli.
Sequence:IPTTPITTTYFFFK
MW:1677 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102996-804)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103007-804)
Supplier: Anaspec Inc
Description: This peptide is Exendin-4 labeled with fluorescein at the Tryptophan residue. FLEX is equipotent to GLP-1(7-36)-amide and exendin-4 as an inhibitor of [125I] GLP-1 binding to the human GLP-1 receptor stably expressed in CHO cells, and maintains full biological potency and efficacy as measured by the stimulation of cAMP accumulation in these cells. FLEX binding to CHO/hGLP-1R membranes results in an increase in fluorescence anisotropy. The binding is specific and saturable (Kd = 2.0 +/- 0.4 nM), and GLP-1(7-36)-amide and Exendin-4 are equipotent inhibitors of FLEX binding to the human GLP-1 receptor. Thus, FLEX is a potent, biologically active ligand that is useful for the study of the binding and functional characteristics of the human GLP-1 receptor.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2
MW: 4606.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103007-104)
Supplier: Anaspec Inc
Description: This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL
Molecular Weight: 2068.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
81 - 96 of 1,910
no targeter for Bottom