You Searched For: Anaspec Inc

Catalog Number: (103009-944)

Supplier: Anaspec Inc

Description: PAMP (1-20) is a biologically active molecule produced by posttranslational processing of proadrenomedullin. This peptide is found in a variety of tissues and exerts important biological activities through specific cell surface receptors. PAMP (1-20) is involved in many physiological processes, including vasodilation, bronchodilation, hormone secretion, cell migration, apoptosis, and angiogenesis. This peptide has been implicated in the pathophysiology of several diseases such as renal and cardiovascular disorders, stroke, cancer, and diabetes.
Sequence:ARLDVASEFRKKWNKWALSR-NH3
MW:2460.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103003-050)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103006-262)

Supplier: Anaspec Inc

Description: This peptide is a HLA-DRB 0101-restricted epitope from Influenza hemagglutinin (307-319).
Sequence:PKYVKQNTLKLAT
MW:1503.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-734)

Supplier: Anaspec Inc

Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (244-274) is a 31-amino acid long peptide derived from the Repeat 1 domain.
Sequence:Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
MW:3299.83 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-116)

Supplier: Anaspec Inc

Description: Des-octanoyl (or Des-acyl) Ghrelin is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQKAQQRKESKKPPAKLQPR
MW: 3188.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Description: Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103009-016)

Supplier: Anaspec Inc

Description: This peptide corresponds to amino acid residues 1-8 of histone H3.
Sequence:ARTKQTAR
MW:931.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102999-774)

Supplier: Anaspec Inc

Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:Biotin-YGGFLRRIRPKLKWDNQ
MW:2373.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-898)

Supplier: Anaspec Inc

Description: DEAC, acid is a useful blue fluorescent building block for labeling amine-containing biomolecules.

Catalog Number: (102996-450)

Supplier: Anaspec Inc

Description: This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500.
Sequence:Z-GGR-AFC
MW:633.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-388)

Supplier: Anaspec Inc

Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Description: This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103010-470)

Supplier: Anaspec Inc

Description: β-galactosidase, encoded by the lacZ gene in E

Catalog Number: (103006-914)

Supplier: Anaspec Inc

Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-822)

Supplier: Anaspec Inc

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This peptide sequence is found in residues 45 to 54 of Metastin (also referred to as Kisspeptin-10). This peptide increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone) in prepubertal dairy heifers. This peptide is the minimal sequence needed to activate GPR54 signaling, which may function in negatively regulating CXCR4’s role in programming tumor metastasis. Specifically, Kisspeptin-10 inhibits signaling and chemotaxis induced by SDF-1.
Sequence:YNWNSFGLRF-NH2
MW:1302.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-070)

Supplier: Anaspec Inc

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases.
This peptide is a cathepsin S substrate fluorescently labeled with AMC (Ex/Em=354 nm/442 nm). It can be used to measure cathepsin S activity.
Sequence:Ac-KQKLR-AMC
MW:871.1 Da
% peak area by HPLC:95
Storage condition:-20° C