You Searched For: Anaspec Inc

Catalog Number: (103011-046)

Supplier: Anaspec Inc

Description: DABCYL acid is the abbreviation of 4-(dimethylaminoazo)benzene-4-carboxylic acid. In some literature, DABSYL (4-dimethylaminoazobenzene-4'-sulfonyl chloride) is misused as ‘DABCYL’. DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL dyes are often paired with EDANS in FRET-based fluorescent probes.

Catalog Number: (103011-052)

Supplier: Anaspec Inc

Description: Although DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates, its extremely high hydrophobicity and resultant poor water solubility have limited its use in the development of sensitive fluorogenic FRET probes. DABCYL Plus™ is developed to address this limitation. DABCYL Plus™ retains spectral properties similar to those of DABCYL. This feature enables researchers to keep all assay settings similar to those of DABCYL’s probes. In addition, DABCYL Plus™ has much greater water solubility than DABCYL. We have used DABCYL Plus™ to develop various protease substrates. In some cases, it has demonstrated greatly improved enzyme performance.

Catalog Number: (103011-050)

Supplier: Anaspec Inc

Description: DABCYL C2 maleimide is an excellent thiol-reactive building block for developing DABCYL-based FRET probes.

Catalog Number: (103011-084)

Supplier: Anaspec Inc

Description: B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. Its primary absorption peak is at 545 nm with a secondary peak at 563 nm. B-PE consists of a, b and g subunits and is present as (ab)6g. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE labeled streptavidin, primary and secondary antibodies have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Catalog Number: (103009-612)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is di-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
MW:3170.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-050)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103003-048)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes.
Sequence:RPKPQQFFGLM-NH2
MW:1347.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-450)

Supplier: Anaspec Inc

Description: This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500.
Sequence:Z-GGR-AFC
MW:633.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-450)

Supplier: Anaspec Inc

Description: This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103007-492)

Supplier: Anaspec Inc

Description: This is fragment of the myelin basic protein (MBP), which induces moderate experimental autoimmune encephalomyelitis (EAE) symptoms in immunized mice. It corresponds to amino acids 83-96 of the murine sequence (85-98 in guinea pig; 86-99 in human).
Sequence:VVHFFKNIVTPRTP
MW:1655 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-462)

Supplier: Anaspec Inc

Description: This is amino acids 81 to 111 fragment of the NY-ESO-1. The NY-ESO-1 antigen is expressed by many tumors of different histological types (including breast, prostate, lung, and melanoma) and by male germline cells, but not by other normal tissues. NY-ESO-1 encodes MHC class I- and class II-restricted peptides expressed by a diverse range of cancers and recognized by T cells. This peptide is pan-MHC class II-restricted sequence that is capable of binding to multiple HLA-DR and HLA-DP4 molecules, including HLA-DRB1*0101, 0401, 0701, and 1101 and HLA-DPB1*0401 and 0402 molecules.
Sequence:LLEFYLAMPFATPMEAELARRSLAQ
MW:2869.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-444)

Supplier: Anaspec Inc

Description: This peptide inhibits binding of one of formyl peptide receptor-like 1 (FPRL1) agonists WKYMVm to its specific receptor. FPRL1 is an important classical chemoattractant receptor that is expressed in phagocytic cells in the peripheral blood and brain. Activation of FPRL1 is closely related to inflammatory responses in the host defense mechanism and neurodegenerative disorders.
Sequence:WRWWWW
MW:1105.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-410)

Supplier: Anaspec Inc

Description: AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence:AMARAASAAALARRR
MW:1542.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-510)

Supplier: Anaspec Inc

Description: Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes