You Searched For: Anaspec Inc

Catalog Number: (103008-422)

Supplier: Anaspec Inc

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This amidated peptide sequence is found in C-terminal residues 110 to 119 of the neurohormone Metastin (also referred to as Kisspeptin-10); it increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone).
Sequence:YNWNSFGLRY-NH2
MW:1318.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-446)

Supplier: Anaspec Inc

Description: This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103006-122)

Supplier: Anaspec Inc

Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-160)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Catalog Number: (103010-128)

Supplier: Anaspec Inc

Description: HRP conjugates are extensively used as secondary detection reagents in ELISAs, immuno-histochemical techniques and Northern, Southern and Western blot analyses.

Catalog Number: (103010-122)

Supplier: Anaspec Inc

Description: Conjugates of calf intestinal alkaline phosphatase are extensively used as secondary detection reagents in ELISAs, immunohistochemical techniques and Northern, Southern and Western blot analyses

Supplier: Anaspec Inc

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Catalog Number: (103010-794)

Supplier: Anaspec Inc

Description: 6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.

Catalog Number: (103009-978)

Supplier: Anaspec Inc

Description: Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466
Sequence: YGRKKRRQRRRGGVGNDFFINHETTGFATEW
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103009-918)

Supplier: Anaspec Inc

Description: This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-692)

Supplier: Anaspec Inc

Description: This peptide is scrambled sequence of JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide, cat# 61298.Related Product: JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL Peptide, cat# 61298.
Sequence: RCGPDCFDNYGRYKYCF
MW: 2107.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103011-026)

Supplier: Anaspec Inc

Description: 5-FTSC reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones that are somewhat less stable, though they may be formed faster (compared to ketones). These hydrazones are generally reduced with sodium borohydride (NaBH4) to further increase the stability of the linkage. 5-FTSC has been used to make a wide variety of biomolecules such as L-aspartase-a-decarboxylase, enzyme-oxidized live plant protoplasts, immunoglobulins, thrombin and antithrombin.

Catalog Number: (103011-014)

Supplier: Anaspec Inc

Description: Sulforhodamine 101 C2 maleimide is an excellent thiol-reactive reagent for protein modifications. It reacts with thiol compounds such as amino acid, peptides and proteins to give bright red fluorescent conjugates that have the identical fluorescent spectral properties of Texas Redâ-derived biopolymers, in particular, antibodies.

Catalog Number: (103011-054)

Supplier: Anaspec Inc

Description: The absorption spectrum of DABCYL Plus™ is environment-sensitive as in the case of DABCYL dyes. For example, in water, the spectrum of DABCYL Plus™ is red-shifted ca. 40 nm compared to that in methanol.

Catalog Number: (103011-048)

Supplier: Anaspec Inc

Description: DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL, SE is the amino-reactive form of DABCYL, and widely used to prepare a variety of FRET-based probes that contain DABCYL.

Catalog Number: (103011-012)

Supplier: Anaspec Inc

Description: Maleimides are among the most frequently used reagents for thiol modification. In most proteins, the sites of reactions are at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions. Tetramethylrhodamine-5-maleimide is widely used for thiol modifications of peptides and proteins.