You Searched For: Anaspec Inc

Catalog Number: (103007-672)

Supplier: Anaspec Inc

Description: This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103003-382)

Supplier: Anaspec Inc

Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 4 units of gammaGlu-Cys.
Sequence:(γE-C)4-G
MW:1004.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103011-186)

Supplier: Anaspec Inc

Description: Long wavelength fluorescent indicator for quantifying intracellular Ca2+ concentration

Catalog Number: (103010-890)

Supplier: Anaspec Inc

Description: 7-Hydroxycoumarin-3-carboxylic acid is one of the most popular blue fluorophores for labeling proteins and nucleic acids mostly through the in situ formation of its succinimidyl ester (81206). This coumarin is also increasingly used to label peptides, nucleotides and carbohydrates.

Catalog Number: (103006-990)

Supplier: Anaspec Inc

Description: This peptide is beta-Amyloid (1-15), human sequence.Sequence: DAEFRHDSGYEVHHQ
Molecular Weight: 1826.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-474)

Supplier: Anaspec Inc

Description: β-galactosidase, encoded by the lacZ gene in <italic>E. coli</italic>, is widely used as a reporter enzyme to study gene expression, protein-protein interaction and normalization of transfection efficiency in mammalian cells.

Catalog Number: (103006-666)

Supplier: Anaspec Inc

Description: This peptide corresponds to amino acids 4 to 18 of rat atrial natriuretic peptide (ANP). It has been used as a cystein containing peptide model in quantitative mass spectroscopic analysis. This fragment is also related to C-ANP (4-23);  (Des-Gln18,des-Ser19,des-Gly20,22,des-Leu21), which is completely selective in discriminating rat C-AMP receptors.
Sequence:RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
MW:1594.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103006-928)

Supplier: Anaspec Inc

Description: The Bid BH3 is a pro-apoptotic member of the 'BH3-only' subset of BCL-2 family proteins that constitute a critical control point in apoptosis. r8BIDBH3 is lethal to human leukemia cell lines that expresse Bcl-2. The Bcl-2 antagonists may have the potential to be efficacious in cancer therapy. Poly-D-arginine (d-isomer as denoted by rrrrrrrr) is fused to the Bid BH3 peptide to facilitate cellular uptake of the peptide.
Sequence:RRRRRRRRGEDIIRNIARHLAQVGDSMDR
MW:3616.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-552)

Supplier: Anaspec Inc

Description: The renin–angiotensin system (RAS) plays a central role in the regulation of blood pressure and electrolyte homoeostasis. An overactive renin-angiotensin system leads to hypertension. As a result, renin is an attractive target for the treatment of this disease

Recombinant mouse prorenin is produced in HEK cells and purified by chelated metal affinity chromatography. It contains an 8x-Histidine tag at the C terminus. The apparent Mr of recombinant enzyme on SDS-PAGE is 41.7 kDa. Prorenin, the precursor of renin, is a glycosylated aspartic protease that consists of 2 homologous lobes. Prorenin can be activated with trypsin. Its activity can be measured in a FRET-based enzymatic assay

Catalog Number: (103003-386)

Supplier: Anaspec Inc

Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of gammaGlu-Cys.
Sequence:(γE-C)2-G
MW:540.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-162)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Catalog Number: (103007-612)

Supplier: Anaspec Inc

Description: Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-322)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1-21. It is dimethylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2
MW:2750.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-054)

Supplier: Anaspec Inc

Description: A more potent suppressor of neuronal cell death than humanin (HN), 10nM of this Gly14 substituted HN blocked cytotoxicity compared to 10uM of HN.
Sequence:MAPRGFSCLLLLTGEIDLPVKRRA
MW:2657.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-232)

Supplier: Anaspec Inc

Description: Beta-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes.
Sequence: YPFPGPI
MW: 789.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-418)

Supplier: Anaspec Inc

Description: Caloxins are extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 2A1 is a PM Ca2+ pump inhibitor selectively binding to an extracellular domain. It inhibits Ca2+-Mg2+-ATPase in human erythrocyte leaky ghosts. Caloxin 2A1 is active at an extracellular site, the peptide can simply be added exogenously to inhibit the plasma membrane calcium ATPase (PMCA). Related peptides: Caloxin 1A1 (cat# 62605) and Caloxin 3A1 (cat# 62606).
Sequence:VSNSNWPSFPSSGGG
MW:1479.5 Da
% peak area by HPLC:95
Storage condition:-20° C