Human Beta-Amyloid (5-42)

Supplier: Anaspec Inc

AS-60087-01 AS-60087-1
103002-974EA 279.15 USD
103002-974 103002-976
Human Beta-Amyloid (5-42)
Proteins and Peptides

This peptide is beta-amyloid N-terminally truncated to obtain 5-42 peptide.
Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4051.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR