You Searched For: Anaspec Inc

Catalog Number: (103007-972)

Supplier: Anaspec Inc

Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:5-FAM-RQIKIWFQNRRMKWKK-NH2
MW:2604.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-442)

Supplier: Anaspec Inc

Description: This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103008-426)

Supplier: Anaspec Inc

Description: This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-g). B8R binding to IFN-g neutralizes its antiviral activity.
Sequence:TSYKFESV
MW:960.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-438)

Supplier: Anaspec Inc

Description: This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103008-422)

Supplier: Anaspec Inc

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This amidated peptide sequence is found in C-terminal residues 110 to 119 of the neurohormone Metastin (also referred to as Kisspeptin-10); it increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone).
Sequence:YNWNSFGLRY-NH2
MW:1318.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-446)

Supplier: Anaspec Inc

Description: This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Catalog Number: (103009-620)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 1-25. It is acetylated at lysine 5/8/12/16.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
MW:2373.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-700)

Supplier: Anaspec Inc

Description: H3K69 methylation is generally associated with transcriptional activation, with methylation catalyzed by DOT/DOT1L enzyme in the context of a nucleosome. Aberrant methylation of H3K79 has been implicated in leukemias. Histone H3 (69-89) peptides are used for assessing the specificity of anti-H3K79me antibodies.
Sequence:RLVREIAQDFKTDLRFQSSAV-NH2
MW:2479 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102999-350)

Supplier: Anaspec Inc

Description: This is the 22-35 fragment of b-Amyloid peptide (human, mouse, rat).
Sequence: EDVGSNKGAIIGLM
Molecular Weight: 1403.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103006-122)

Supplier: Anaspec Inc

Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Catalog Number: (103010-794)

Supplier: Anaspec Inc

Description: 6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.

Catalog Number: (103006-056)

Supplier: Anaspec Inc

Description: Protection activity of humanin (HN) against neuronal cell death is abrogated in this peptide, where Cys8 is substituted by Ala.
Sequence:MAPRGFSALLLLTSEIDLPVKRRA
MW:2655.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Catalog Number: (102996-368)

Supplier: Anaspec Inc

Description: This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C