You Searched For: Anaspec Inc


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103006-344)
Supplier: Anaspec Inc
Description: GRGDS is the cell adhesion sequence of osteopontin that recognizes the avb3 integrin. Osteopontin is overexpressed in experimental models of malignancy.
Sequence:GRGDS
MW:490.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-346)
Supplier: Anaspec Inc
Description: This peptide inhibits the adhesion of human ovarian carcinoma OVCAR-3 cells to fibronectin, but not to laminin.
Sequence:GRGDS-NH2
MW:489.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-400)
Supplier: Anaspec Inc
Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 6 units of gammaGlu-Cys.
Sequence:(γE-C)6-G
MW:1468.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-356)
Supplier: Anaspec Inc
Description: This octapeptide is a COOH-terminal fragment of the C3a anaphylatoxin peptide. On a molar basis, this peptide possesses 1-2% of the biological activities of C3a. It causes contraction of rodent ileum and uterus, release of vasoactive amines from rat mast cells, and increases vascular permeability in guinea pig and human skin. Both purified C3a and synthetic C3a (70-77), which retains partially the activity of anaphylatoxin, are shown to interact directly with human lymphocytes.
Sequence:ASHLGLAR
MW:823.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-372)
Supplier: Anaspec Inc
Description: Prion protein (PrP), also known as CD230, is mainly produced in the nervous sytem. PrP exists as different isoforms, among which the normal PrPc, and the 'scrapie' isoform PrPSc. PrPSc is misfolded and associated to multiple disorders including bovine spongiform encephalopathy, Gerstmann-Straüssler-Scheindker disease (GSS) and the Creutzfeldt-Jakob disease. It contains a much higher beta-sheet content than PrPc, and tends to form protease-resistant aggregates. A hypothesis to support the propoagation of these aggregates and their role in neurodegeneration is that the change from normal PrPc is due to its interaction with PrPSc 'conformation conversion hypothesis).
PrP 127-147 forms filamentous structures ressembling scrapie-associated fibrils, but possesses a lower amyloidogenic potential than PrP 106-126.
Sequence:KTNMKHMAGAAAAGAVVGGLG
MW:1912.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-230)
Supplier: Anaspec Inc
Description: MMP-1 (interstitial collagenase, fibroblast collagenase) is an extracellular protease


Catalog Number: (103010-244)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103010-232)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103010-234)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103010-688)
Supplier: Anaspec Inc
Description: AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species with strong affinity (1-4). Protein A consists of five IgG binding domains (A, B, C, D, and E), each approximately 60 amino acids long with no cysteines present and two S. aureus cell membrane binding domains, X and M (3).
Application: Recombinant Protein A can be used for immunoprecipitation, antibodies purification, and assay development.


Catalog Number: (103010-644)
Supplier: Anaspec Inc
Description: Cathepsin L, a lysosomal endopeptidase, is a member of the papain-like family of cysteine proteinases


Catalog Number: (103010-638)
Supplier: Anaspec Inc
Description: AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103010-662)
Supplier: Anaspec Inc
Description: Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues


Catalog Number: (103010-618)
Supplier: Anaspec Inc
Description: Nicotinamide nucleotides are key players in the energy transforming and oxidation-reduction reactions of a cell


Catalog Number: (103010-690)
Supplier: Anaspec Inc
Description: This is biotinylated Protein A conjugate suitable for asssay development, IHC, IF, immunoprecipitation or western blotting.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development


Catalog Number: (103003-204)
Supplier: Anaspec Inc
Description: The native peptide, HATPPKKKRK (cat# 60522-1), is a substrate for cyclin-dependent protein kinase 1 (CDC2; CDK1). The fluorescent and biotinylated peptides are used to develop assays for CDK1.
Sequence:HATPPKKKRK
MW:1190.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 1,910
no targeter for Bottom