You Searched For: H-D-Ala-Leu-Lys-AMC

Supplier: Anaspec Inc

Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: ALADDIN SCIENTIFIC

Description: Sequence:Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-AlaBiochemical mechanism:Amyloid protein β Protein segment 1-42 (A β  1-42) It has antioxidant and neuroprotective properties. Amyloid protein β Protein accumulation is associated with Alzheimer's disease (AD) and Down syndrome. A β  1-42 regulates cholesterol transport and acts as a transcription factor. It may also have anti-inflammatory and antimicrobial effects.Application:Amyloid protein is found in the brain of patients with Alzheimer's disease and Down syndrome β- The main segment of the protein.Amyloid protein β Protein fragments 1-42 have been used to:1. A β  Preparation of 1-42 oligomer2. Western blot analysis3. Immunomagnetic Reduction (IMR) Plasma A β 42 Detected interference test4. Study the effect of resveratrol on A β  1-42 induced impairment of spatial learning, memory and synaptic plasticity5. Study A β Role in epithelial cell culture

New Product

Supplier: Bachem Americas

Description: Fluorogenic (FRET) substrate for pro-memapsin-2 containing the β-secretase site EVNLDAEF of the Swedish mutation of APP. The kinetic parameters at pH 4.5 are Km = 5.4 µM and kcat = 0.24 min⁻¹.

Supplier: Enzo Life Sciences

Description: Produced in <i>E. coli.</i> Non-glycosylated homodimer, containing two 117 amino acids chains. To enable bacterial expression the N-terminal sequence of Ala-Pro-Leu-Thr was replaced with a Lys.

Supplier: Bachem Americas

Description: PG 99-465 is a high affinity, selective VPAC2 receptor antagonist. It exhibited a 100-fold preference for the VPAC2 over the VPAC1 receptor. The compound showed partial agonistic activity on the VPAC1 receptor and was inactive on the VPAC2 receptor transfected in CHO cells, as well as on naturally expressed human VPAC2 receptors in the SUP T1 cell line. Dickson et al. observed an agonistic effect of PG99-465 on the human VPAC1 and PAC1 receptors. When applied singly, PG99-465 increased [cAMP](i) at all three hVPAC/PAC receptor subtypes.

Catalog Number: (M-2485.0001BA)

Supplier: Bachem Americas

Description: Fluorogenic (FRET) substrate for pro-memapsin-2 containing the β-secretase site of the Swedish mutation of APP. The kinetic parameters of Mca-SEVNLDAEFK(Dnp) amide at pH 4.5 are Km = 4.5 µM and kcat = 0.25 min⁻¹.

Supplier: Thermo Scientific Chemicals

Description: Molecular Formula: C89H152N22O15
Formula Weight: 1770.29
Storage Temperature: -30°C to -10°C
Physical Form: Lyophilized powder
Appearance: White to off-white
Solubility: Soluble in water at 1mg/ml
MDL No.: MFCD01630779

Certificates

Catalog Number: (103006-262)

Supplier: Anaspec Inc

Description: This peptide is a HLA-DRB 0101-restricted epitope from Influenza hemagglutinin (307-319).
Sequence:PKYVKQNTLKLAT
MW:1503.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-888)

Supplier: Anaspec Inc

Description: This is a biotinylated synthetic peptide substrate for S6 kinase.
Sequence:Biotin-AKRRRLSSLRA-NH2
MW:1538.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (H-2020.0100BA)

Supplier: Bachem Americas

Description: Short histidine-containing peptides can form stable complexes with copper and other transition metals. See also His-Leu (G-2310) and the product family 'Liver Cell Growth Factor (GHK) and Analogs'.

Catalog Number: (10815-444)

Supplier: Thermo Scientific Chemicals

Description: Molecular Formula: C119H182N34O31
Formula Weight: 2584.90
Storage Temperature: -30°C to -10°C
Physical Form: Solid
Appearance: White to off-white

Catalog Number: (N-2005.0500BA)

Supplier: Bachem Americas

Description: Tertiapin Q (TPN Q) shows the same channel-blocking activity as the bee venom peptide tertiapin (N-1745), but increased stability due to the exchange of Met¹³ by Gln.

Catalog Number: (102996-268)

Supplier: Anaspec Inc

Description: The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Bachem Americas

Description: Sensitive internally quenched fluorogenic (FRET) substrate for SARS main protease with a Km value of 17 µM and a kcat value of 1.9 s⁻¹.

Catalog Number: (I-1615.0050BA)

Supplier: Bachem Americas

Description: Sequence: Z-Leu-Leu-Arg-AMC

Supplier: Anaspec Inc

Description: This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C