Print…

You Searched For: H-D-Ala-Leu-Lys-AMC


10,445  results were found

Refine Results Sort by
SearchResultCount:"10445"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-ALE118901-5MG

β-Endorphin, rat

Supplier: ALADDIN SCIENTIFIC
Description: Amino Acid Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln

New Product

Image Unavailable-L-1725.0050BA

Suc-Ala-Ala-Pro-Lys-pNA

Supplier: Bachem Americas
Description: Substrates often used for characterizing newly isolated PPIases, subtilisins or other enzymes. Bachem offers Suc-Ala-Ala-Pro-Xaa (Suc-AAPX) substrates containing Ala, Leu, Met, Nle, and Nva (the pancreatic elastase substrates L-1775, L-1390, L-1395, and L-1780), Arg, Asp, Glu, Ile, Lys, Orn, Phe (the PPIase substrates I-1465, L-1400, and M-2305), and Val (the neutrophil elastase substrates I-1490 and L-1770) as Xaa.

Image Unavailable-H-5568.1000BA

beta-Amyloid (1-40)

Supplier: Bachem Americas
Description: Compared to the TFA salt, the HCl salt of amyloid β-protein (1-40) easily forms β-structures in PBS within a few hours at 25°C. β-structure formation is essential for amyloid peptide toxicity.
Sequence: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Salt: Hydrochloride

Image Unavailable-10814-784

[Lys3] Bombesin

Catalog Number: (10814-784)
Supplier: Thermo Scientific Chemicals
Description: Lys3 Bombesin, CAS number: 66839-66-5, Molecular Formula: C71H110N22O18S, Form:solid, Synonyms: Glp-Gln-Lys-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2, Size: 1mg

Certificates


Product Image-89161-076

Protein Kinase C (19-31)

Catalog Number: (89161-076)
Supplier: Enzo Life Sciences
Description: Inhibitor of protein kinase C (PKC).
Image Unavailable-L-1710.0050BA

Suc-Ala-Ala-Pro-Glu-pNA

Supplier: Bachem Americas
Description: Substrates often used for characterizing newly isolated PPIases, subtilisins or other enzymes. Bachem offers Suc-Ala-Ala-Pro-Xaa (Suc-AAPX) substrates containing Ala, Leu, Met, Nle, and Nva (the pancreatic elastase substrates L-1775, L-1390, L-1395, and L-1780), Arg, Asp, Glu, Ile, Lys, Orn, Phe (the PPIase substrates I-1465, L-1400, and M-2305), and Val (the neutrophil elastase substrates I-1490 and L-1770) as Xaa.

Image Unavailable-102996-536

Human beta-Endorphin

Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-H-7252.0500BA

Human ((13C6)Leu5)-Ghrelin Trifluoroacetate

Catalog Number: (H-7252.0500BA)
Supplier: Bachem Americas
Description: Stable isotope-labeled human ghrelin useful for pharmacokinetic/pharmacodynamic studies.
Image Unavailable-H-7286.1000BA

Pg 97-269 Trifluoroacetate

Supplier: Bachem Americas
Description: PG 97-269 is a selective high affinity VPAC1 receptor antagonist with negligible affinity for the PACAP type I receptor. The Ki values were 15 +/- 5 nM for the rat and 2 +/- 1 nM for the human VPAC1 receptors. PG 97-269 may be useful for the evaluation of the physiological role of VIP in rat and human tissues.

Image Unavailable-M-2420.0001BA

Mca-(Asn⁶⁷⁰,Leu⁶⁷¹)-Amyloid beta/A4 Protein Precursor₇₇₀ (667-675)-Lys(Dnp) Acetate

Catalog Number: (M-2420.0001BA)
Supplier: Bachem Americas
Description: Fluorogenic (FRET) substrate for pro-memapsin-2 containing the β-secretase site of the Swedish mutation of APP, SEVNLDAEF.
Image Unavailable-10305-350

Anti-Ghrelin 28 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10305-350)
Supplier: Bioss
Description: Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Also known as Appetite regulating hormone; GHRL; Growth hormone releasing peptide; Growth hormone secretagogue; M46 protein; Motilin related peptide; MTLRP; Obestatin; Obestatin preprohormone; PRO1066; UNQ524. Sequence notes: Gly-Ser-Ser-Phe-Leu-Ser-Pro- Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu- Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro- Arg (mo, rat).
Image Unavailable-10305-352

Anti-Ghrelin 28 Rabbit Polyclonal Antibody (HRP (Horseradish PE (Phycoerythrin)rOxidase))

Catalog Number: (10305-352)
Supplier: Bioss
Description: Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Also known as Appetite regulating hormone; GHRL; Growth hormone releasing peptide; Growth hormone secretagogue; M46 protein; Motilin related peptide; MTLRP; Obestatin; Obestatin preprohormone; PRO1066; UNQ524. Sequence notes: Gly-Ser-Ser-Phe-Leu-Ser-Pro- Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu- Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro- Arg (mo, rat).
Image Unavailable-10305-346

Anti-Ghrelin 28 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10305-346)
Supplier: Bioss
Description: Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Also known as Appetite regulating hormone; GHRL; Growth hormone releasing peptide; Growth hormone secretagogue; M46 protein; Motilin related peptide; MTLRP; Obestatin; Obestatin preprohormone; PRO1066; UNQ524. Sequence notes: Gly-Ser-Ser-Phe-Leu-Ser-Pro- Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu- Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro- Arg (mo, rat).
Image Unavailable-10305-344

Anti-Ghrelin 28 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10305-344)
Supplier: Bioss
Description: Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Also known as Appetite regulating hormone; GHRL; Growth hormone releasing peptide; Growth hormone secretagogue; M46 protein; Motilin related peptide; MTLRP; Obestatin; Obestatin preprohormone; PRO1066; UNQ524. Sequence notes: Gly-Ser-Ser-Phe-Leu-Ser-Pro- Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu- Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro- Arg (mo, rat).
Image Unavailable-10305-342

Anti-Ghrelin 28 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10305-342)
Supplier: Bioss
Description: Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Also known as Appetite regulating hormone; GHRL; Growth hormone releasing peptide; Growth hormone secretagogue; M46 protein; Motilin related peptide; MTLRP; Obestatin; Obestatin preprohormone; PRO1066; UNQ524. Sequence notes: Gly-Ser-Ser-Phe-Leu-Ser-Pro- Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu- Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro- Arg (mo, rat).
Image Unavailable-10305-348

Anti-Ghrelin 28 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10305-348)
Supplier: Bioss
Description: Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release. Ghrelin is derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Also known as Appetite regulating hormone; GHRL; Growth hormone releasing peptide; Growth hormone secretagogue; M46 protein; Motilin related peptide; MTLRP; Obestatin; Obestatin preprohormone; PRO1066; UNQ524. Sequence notes: Gly-Ser-Ser-Phe-Leu-Ser-Pro- Glu-His-Gln-Lys-Ala-Gln-Gln-Arg-Lys-Glu- Ser-Lys-Lys-Pro-Pro-Ala-Lys-Leu-Gln-Pro- Arg (mo, rat).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
33 - 48 of 10,445
no targeter for Bottom