You Searched For: Anaspec Inc

Catalog Number: (103007-104)

Supplier: Anaspec Inc

Description: This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL
Molecular Weight: 2068.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-098)

Supplier: Anaspec Inc

Description: This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102997-410)

Supplier: Anaspec Inc

Description: Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:5-TMR-KVEKIGEGTYGVVYK
MW:2082.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-612)

Supplier: Anaspec Inc

Description: Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-662)

Supplier: Anaspec Inc

Description: This is a histone 4 peptide acetylated at lysine 8. In some studies, this histone modification is thought to predict prognosis of resected non-small-cell lung cancer. This peptide has also been shown to play a role in somatic hypermutation (SHM) possible owing to its modification that likely mediates recruitment of error-prone DNA polymerases at the DNA repair stage of SHM.
Sequence:SGRGKGG-K(Ac)-GLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-616)

Supplier: Anaspec Inc

Description: PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay.
Sequence: 5-FAM-(β-A)-(β-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
MW: 1784.3Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-624)

Supplier: Anaspec Inc

Description: This is a myristoylated PKCζ pseudosubstrate-derived ζ-inhibitory peptide (ZIP) found to inhibit an atypical type of Protein Kinase C ζ (zeta). It has been shown to also interact with PKC family isoforms and disrupt conventional PKC targeting and translocation leading to physiological memory impairment. The sequence corresponds to the pseudosubstrate region of the N-terminal regulatory domain that maintains the enzyme in an inactive form in the absence of activator. The pseudosubstrate peptide has also been shown to be a competitive inhibitor of PKCζ in neurons. This peptide was also used to demonstrate that PKC ζ is involved in the regulation of integrin-dependent adhesion and chemotaxis of intact human neutrophils.
Sequence:Myr-SIYRRGARRWRKL
MW:1928.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-672)

Supplier: Anaspec Inc

Description: This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103007-636)

Supplier: Anaspec Inc

Description: Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-648)

Supplier: Anaspec Inc

Description: This is a dimethylated lysine at position 4 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites (TSS). It has been observed that a subgroup of genes linked to T cell functions showed high levels of H3K4me2 within their gene body. While enrichment for H3K4me2 within the gene body is a characteristic trait of expressed genes in yeast, in contrast, H3K4me2 has been shown to be predominantly enriched around the TSS in mammals.
Sequence:ART-K(Me2)-QTARKSTGGKAPRKQLA
MW:2282.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-646)

Supplier: Anaspec Inc

Description: This is H2A, one of the core histones DNA associates with to form nucleosome. This 1-20 H2A peptide is unique among histones in that its C-terminal end is exposed for potential covalent modifications.
Sequence: SGRGKQGGKARAKAKTRSSR
MW:2087.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid N-terminally truncated to obtain 5-42 peptide.
Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4051.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (102996-096)

Supplier: Anaspec Inc

Description: This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (102996-082)

Supplier: Anaspec Inc

Description: Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed by cleavage of Ang I by the angiotensin-converting enzyme (ACE) or chymases. Human heart chymase, a chymotrypsin-like serine proteinase, hydrolyzes the Phe8-His9 bond to yield the octapeptide hormone angiotensin II and His-Leu.
Sequence: DRVYIHPF
MW: 1046.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (102996-086)

Supplier: Anaspec Inc

Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C