You Searched For: gastrod

Catalog Number: (103006-440)

Supplier: Anaspec Inc

Description: This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (10271-064)

Supplier: Bioss

Description: CacyBP is a 228 amino acid protein encoded by the human gene CACYBP. CacyBP is primarily a nuclear protein that contains one CS domain and one SGS domain. CacyBP is believed to be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It most likely serves as a molecular bridge in ubiquitin E3 complexes. It also participates in the ubiquitin-mediated degradation of b-catenin. CacyBP is thought to be a potential inhibitor of cell growth and invasion in the gastric cancer cell through its effects on b-catenin protein expression and transcriptional activation of TCF/LEF.

Catalog Number: (10269-246)

Supplier: Bioss

Description: CacyBP is a 228 amino acid protein encoded by the human gene CACYBP. CacyBP is primarily a nuclear protein that contains one CS domain and one SGS domain. CacyBP is believed to be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It most likely serves as a molecular bridge in ubiquitin E3 complexes. It also participates in the ubiquitin-mediated degradation of b-catenin. CacyBP is thought to be a potential inhibitor of cell growth and invasion in the gastric cancer cell through its effects on b-catenin protein expression and transcriptional activation of TCF/LEF.

Catalog Number: (10271-060)

Supplier: Bioss

Description: CacyBP is a 228 amino acid protein encoded by the human gene CACYBP. CacyBP is primarily a nuclear protein that contains one CS domain and one SGS domain. CacyBP is believed to be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It most likely serves as a molecular bridge in ubiquitin E3 complexes. It also participates in the ubiquitin-mediated degradation of b-catenin. CacyBP is thought to be a potential inhibitor of cell growth and invasion in the gastric cancer cell through its effects on b-catenin protein expression and transcriptional activation of TCF/LEF.

Catalog Number: (76195-898)

Supplier: Prosci

Description: Hepatocyte Paraffin 1 or HepPar-1 localizes to the mitochondria of hepatocytes. It is a sensitive marker for distinguishing hepatocellular carcinomas (HCC) from other metastatic carcinomas as well as cholangio-carcinomas. HCC s occur primarily in the stomach, but they are also found in many other organs. The Hepatocyte Specific Antigen may also be a useful marker for intestinal metaplasia. Reportedly, strong expression of the Hepatocyte Specific Antigen correlates with smaller tumor size and longer patient survival. Occasionally, Hepatocyte Specific Antigen is also found in gastric carcinomas as well as in a few other non-hepatic tumors.

Catalog Number: (77439-474)

Supplier: Bioss

Description: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. (provided by RefSeq, Jul 2008).

Catalog Number: (76196-076)

Supplier: Prosci

Description: Thymidylate synthase converts deoxyuridine monophosphate (dUMP) to deoxythymidine monophosphate (dTMP), which is essential for DNA biosynthesis. Thymidylate synthase is also a critical target for the fluoropyrimidines, an important group of anti-neoplastic drugs that are widely used in the treatment of solid tumors. Both 5-FU and fluorodeoxyuridine are converted in tumor cells to FdUMP which inactivates thymidylate synthase by formation of a ternary covalent complex in the presence of the folate cofactor 5,10-methylenetetrahydrofolate. Expression of thymidylate synthase protein is associated with response to 5-fluorouracil (5-FU) in human colorectal, gastric, head and neck, and breast carcinomas.

Catalog Number: (102996-408)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (102996-406)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (10750-810)

Supplier: Prosci

Description: CDX2 Antibody: CDX2 is a member of the caudal homeobox family of transcription factors that also includes the proteins CDX1 and CDX4. CDX2 is strongly expressed in the trophectoderm in the blastocyst with expression maintained within the proliferating extra-embryonic ectoderm during development. It is required for the repression of the transcription of the POU5F1/Oct4 and NANOG genes in the outer cells of the blastocyst and is thus essential for the segregation of the inner cell mass and trophectoderm at the blastocyst stage. Aberrant expression of CDX2 is associated with numerous types of carcinomas, including intestinal metaplasia, gastric carcinoma, and acute myeloid leukemia due to deregulated HOX gene expression.

Supplier: Diagnostic Biosystems

Description: Mutations in DNA mismatch repair genes are associated with hereditary nonpolyposis colorectal cancer (HNPCC). Initially, inherited mutations in the MSH2 and MLH1 homologs of the bacterial DNA mismatch repair genes MutS and MutL were found at high frequency in HNPCC and were shown to be associated with microsatellite instability. The demonstration that 10 to 45% of pancreatic, gastric, breast, ovarian and small cell lung cancers also display microsatellite instability has been interpreted to suggest that DNA mismatch repair is not restricted to HNPCC tumors but is a common feature in tumor initiation or progression.

Supplier: Biotium

Description: Hepatocyte Paraffin 1 or HepPar1 localizes to the mitochondria of hepatocytes. It is a sensitive marker for distinguishing hepatocellular carcinomas (HCC) from other metastatic carcinomas as well as cholangio-carcinomas. HCC s occur primarily in the stomach, but they are also found in many other organs. The Hepatocyte Specific Antigen may also be a useful marker for intestinal metaplasia. Reportedly, strong expression of the Hepatocyte Specific Antigen correlates with smaller tumor size and longer patient survival. Occasionally, Hepatocyte Specific Antigen is also found in gastric carcinomas as well as in a few other non-hepatic tumors.

Catalog Number: (10108-552)

Supplier: Prosci

Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

Catalog Number: (102996-082)

Supplier: Anaspec Inc

Description: Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Biotium

Description: This antibody recognizes the blood group H type 2 antigens, trisaccharide Fuca1-2Galb1-4GlcNAc of human origin. This protein is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal), whereas O individuals lack such activity. It is expressed on endothelial cells, epithelial cells and granulocytes. Increased expression of this antigen has been observed on some tumor tissues such as gastric carcinomas, urothelial carcinomas, and colon carcinomas.

Catalog Number: (75951-156)

Supplier: Biotium

Description: Hepatocyte Paraffin 1 or HepPar1 localizes to the mitochondria of hepatocytes. It is a sensitive marker for distinguishing hepatocellular carcinomas (HCC) from other metastatic carcinomas as well as cholangio-carcinomas. HCC s occur primarily in the stomach, but they are also found in many other organs. The Hepatocyte Specific Antigen may also be a useful marker for intestinal metaplasia. Reportedly, strong expression of the Hepatocyte Specific Antigen correlates with smaller tumor size and longer patient survival. Occasionally, Hepatocyte Specific Antigen is also found in gastric carcinomas as well as in a few other non-hepatic tumors.