Print…

You Searched For: cytometer


321  results were found

Refine Results Sort by
SearchResultCount:"321"

Sort Results

List View Easy View

Rate These Search Results

Product Image-76449-902

Cyto-Chex® BCT Blood Collection Tubes, Streck

Supplier: Streck Laboratories
Description: Cyto-Chex® BCT is a direct draw blood collection tube that maintains cellular morphology and surface antigen expression, including cluster of differentiation (CD) markers prior to analysis by flow cytometry.

Image Unavailable-103889-492

Anti-FMC63 HEK293 Polyclonal Antibody

Supplier: ACROBIOSYSTEMS INC MS
Description: FMC63 scFv Monoclonal Antibody, (Y45) (HEK293), Source: expressed from human 293 cells, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 25tests

Product Image-103879-332

Anti-CD44 Mouse Monoclonal Antibody (PE (Phycoerythrin)) [clone: MEM-85]

Catalog Number: (103879-332)
Supplier: Abnova
Description: Mouse monoclonal antibody raised against native CD44.
Product Image-76484-432

Buccutite™ Rapid PE-Cy5.5 Tandem Antibody Labeling Kits (2 Labelings), AAT Bioquest

Supplier: AAT BIOQUEST INC
Description: PE-Cy5.5 is a popular color used in flow cytometry.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Image Unavailable-76463-996

Anti-ABCC8 Rabbit Polyclonal Antibody (DyL488)

Catalog Number: (76463-996)
Supplier: Boster Biological Technology
Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial
Image Unavailable-103889-298

Anti-FMC63 HEK293 Polyclonal Antibody (PE Labeled)

Catalog Number: (103889-298)
Supplier: ACROBIOSYSTEMS INC MS
Description: FMC63 scFv Monoclonal Antibody, (Y45), PE-Labeled , Source: produced via site-specific conjugation, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 25tests
Product Image-76483-504

5(6)-Carboxyfluorescein diacetate NHS ester [CFSE (5(6)-CFDA SE)] ≥90%, ReadiUse™

Catalog Number: (76483-504)
Supplier: AAT BIOQUEST INC
Description: It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76483-178

Fura Red potassium salt

Supplier: AAT BIOQUEST INC
Description: Fura Red is a visible light-excitable fura-2 analog that offers unique possibilities for ratiometric measurement of calcium ion in single cells by microphotometry, imaging or flow cytometry when used with single excitation, green-fluorescent calcium indicators.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Product Image-76483-182

Fura Red, AM ≥90%

Supplier: AAT BIOQUEST INC
Description: Fura Red is a visible light-excitable fura-2 analog that offers unique possibilities for ratiometric measurement of calcium ion in single cells by microphotometry, imaging or flow cytometry when used with single excitation, green-fluorescent calcium indicators.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Image Unavailable-76463-998

Anti-ABCC8 Rabbit Polyclonal Antibody (DyL550)

Catalog Number: (76463-998)
Supplier: Boster Biological Technology
Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial
Product Image-76483-498

5(6)-Carboxyfluorescein diacetate NHS ester [CFSE (5(6)-CFDA SE)] ≥95%

Catalog Number: (76483-498)
Supplier: AAT BIOQUEST INC
Description: It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76484-438

Buccutite™ Rapid PE-Cy5 Tandem Antibody Labeling Kits (2 Labelings), AAT Bioquest

Supplier: AAT BIOQUEST INC
Description: PE-Cy5 is a popular color used in flow cytometry.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Product Image-76458-732

Streptavidin Conjugates, Biotium

Catalog Number: (76458-732)
Supplier: Biotium
Description: A high quality biotin-binding protein conjugated to Biotium's signature bright and photostable fluorescent CF® dyes, and a selection of other labels.

Certificates


Product Image-76483-500

5(6)-Carboxy-2′,7′- dichlorofluorescein diacetate mixture of isomers ≥95%

Catalog Number: (76483-500)
Supplier: AAT BIOQUEST INC
Description: It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-103879-320

Anti-HLA-G Mouse Monoclonal Antibody (Biotin) [clone: MEM-G/1]

Catalog Number: (103879-320)
Supplier: Abnova
Description: Mouse monoclonal antibody raised against recombinant HLA-G.
Product Image-76414-940

Annexin V Conjugates

Supplier: Biotium
Description: Annexin V fluorescent conjugates can be used to detect apoptotic cells. Annexin V is available conjugated to a wide variety of dyes.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240 of 321
no targeter for Bottom