You Searched For: 6-FITC+DA


30,683  results were found

SearchResultCount:"30683"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Adipogen
Description: Fluorescent reagent with high selectivity.

Supplier: Adipogen
Description: Fluorescent reagent with high selectivity.

Supplier: Adipogen
Description: Fluorescein-diacetate-5-isothiocyanate has a lambdaex of 497nm and a lambdaem of 517nm in 0.1 M phosphate pH 7.0.

Supplier: AFG BIOSCIENCE LLC
Description: Anti-Da-3 Rabbit Polyclonal Antibody (FITC)

New Product

Catalog Number: (103008-438)
Supplier: Anaspec Inc
Description: This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: This fluorescent (FITC)-labeled TAT peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm.
Sequence: FITC-LC-YGRKKRRQRRR-NH2
MW: 2061.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103003-270)
Supplier: Anaspec Inc
Description: This is a fluorescent (FITC)-labeled Prototype of RGD-containing peptide, Abs/Em=492/516 nm.
Sequence:FITC-LC-GRGDSP
MW:1091.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
This is a fluorescent (FITC)-labeled Antennapedia, Abs/Em = 493/522 nm.
Sequence:FITC-LC-RQIKIWFQNRRMKWKK-NH2
MW:2748.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103002-744)
Supplier: Anaspec Inc
Description: This is a fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: FITC-LC-TYSCHFGPLTWVCKPQGG
MW: 2483.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103007-320)
Supplier: Anaspec Inc
Description: This is amino acids 17 to 26 fragment of p53, fluorescent labeled through an LC spacer. This peptide is the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that come into contact with the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development, FITC (Abs/Em=493 nm/517 nm)..
Sequence:FITC-LC-ETFSDLWKLL-NH2
MW:1753.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103003-082)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Angiotensin II peptide, Abs/Em=494/518 nm. FAM (carboxyfluorescein) exhibits better chemical and photo-stability than FITC.
Sequence: FAM-DRVYIHPF
MW: 1404.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103007-566)
Supplier: Anaspec Inc
Description: This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10230-232)
Supplier: Bioss
Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons. It belongs to the calbindin family. Calbindin 2 (calretinin), closely related to calbindin 1, is an intracellular calcium-binding protein belonging to the troponin C superfamily. Calbindin 1 is known to be involved in the vitamin-D-dependent calcium absorption through intestinal and renal epithelia, while the function of neuronal calbindin 1 and calbindin2 is poorly understood. The sequence of the calbindin 2 cDNA reveals an open reading frame of 271 codons coding for a protein of 31,520 Da, and shares 58% identical residues with human calbindin1.


Catalog Number: (75844-138)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The A20 monoclonal antibody reacts with the leukocytes of the CD45.1-expressing mouse strains (DA, SJL/J, RIII, and STS/A). It does not cross-react with cells that express CD45.2. The CD45 molecule is a member of the Protein Tyrosine Phosphatase (PTP) family, because its intracellular region contains two PTP domains. The extracellular region’s variability is caused by different levels of glycosylation, and the splicing of the 4, 5, and 6 exons. The isoforms found in the mouse strains depend on the activation state, maturation stage and cell type, and are very important in B and T lymphocytes antigen receptor signal transduction. The A20 antibody inhibits some of the B lymphocytes responses, from CD45.1-expressing mice, to lipopolysaccharides and antigens.


Catalog Number: (89361-998)
Supplier: Genetex
Description: Biotin is a water soluble vitamin, generally classified as a B complex vitamin, also called vitamin B4. After the initial discovery of biotin, nearly forty years of research were required to establish it as a vitamin. Biotin is required by all organisms but can only be synthesized by bacteria, yeasts, molds, algae, and some plant species. Biotin is required as prosthetic group of enzymes involved in incorporation of carbon dioxide into organic compounds. Biotin has a MW of 244 Da .


Catalog Number: (103007-610)
Supplier: Anaspec Inc
Description: This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 30,683
no targeter for Bottom