You Searched For: 6-FAM+Alkyne

Supplier: Anaspec Inc

Description: 6-FAM is another isomer of carboxyfluorescein. It is mainly used in sequencing of nucleic acids and labeling nucleotides.

Supplier: Anaspec Inc

Description: This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: AAT BIOQUEST INC

Description: There are several ways of labeling an oligonucleotide with fluorescein.

Supplier: Anaspec Inc

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Catalog Number: (103003-082)

Supplier: Anaspec Inc

Description: This is a fluorescent (FAM)-labeled Angiotensin II peptide, Abs/Em=494/518 nm. FAM (carboxyfluorescein) exhibits better chemical and photo-stability than FITC.
Sequence: FAM-DRVYIHPF
MW: 1404.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103005-940)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-3 and 12 activities, Abs/Em = 494/521nm.
Sequence:5-FAM-RPKPVE-Nva-WRK(QXL™ 520)-NH2
MW:2143.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-250)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-7, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PYAYWMRK(5-FAM)-NH2
MW:1963.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (77463-010)

Supplier: AAT BIOQUEST INC

Description: FAM dye qPCR calibration solution supplied as a 10000X concentrate is compatible with a wide variety of qPCR instruments, including the ABI7500 Fast, QuantStudio™, and ViiA™ seven systems.

Catalog Number: (103005-942)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
MW:1913.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Bachem Americas

Description: For the long-acting GLP-1 analog liraglutide see H-6724.

Catalog Number: (77462-992)

Supplier: AAT BIOQUEST INC

Description: The FAM dye qPCR calibration plate can be used to maintain the 7500 real-time PCR system with fast 96-well block.

Supplier: AAT BIOQUEST INC

Description: 5-TAMRA azide is an excellent alkyne-reactive fluorescent reagent for labeling alkyne-containing biological molecules through the well known click chemistry.

Catalog Number: (76480-946)

Supplier: AAT BIOQUEST INC

Description: 6-ROX azide is an excellent alkyne-reactive fluorescent reagent for labeling alkyne-containing biological molecules through the well known click chemistry.

Supplier: AAT BIOQUEST INC

Description: 6-TAMRA aside is an excellent alkyne-reactive fluorescent reagent for labeling alkyne-containing biological molecules through the well known click chemistry.

Catalog Number: (76481-218)

Supplier: AAT BIOQUEST INC

Description: AAT Bioquest's iFluor® dyes are optimized for labeling proteins, in particular, antibodies.

Supplier: Anaspec Inc

Description: Fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.