You Searched For: Anaspec Inc

Catalog Number: (103011-192)

Supplier: Anaspec Inc

Description: Cell culture reagent for dissolving AM esters.

Catalog Number: (103006-406)

Supplier: Anaspec Inc

Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:RRRRRRRRR
MW:1423.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37), also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3297.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103003-356)

Supplier: Anaspec Inc

Description: ACTH (1–17), and aMSH (a-Melanotropin), both derived from POMC (proopiomelanocortin) are involved in melanogenesis. However, ACTH (1-17) has been found to be more potent in malanogenesis in human malanocytes. Both ACTH (1-17) and aMSH also increase dendricity, and proliferation in follicular melanocytes.
Sequence: SYSMEHFRWGKPVGKKR
MW: 2093.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103006-446)

Supplier: Anaspec Inc

Description: This 36-residue synthetic peptide strongly inhibits HIV-1 viral fusion with CD4 cells with an EC50 of 1 ng/ml.
It is a peptide mimetic of an essential region within the viral envelope glycoprotein gp41 that functions by blocking gp41 structural rearrangements at a transitional pre-fusion conformation.
Sequence:Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
MW:4492 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Somatostatin [SST, GHIH (growth hormone-inhibiting hormone) or SRIF (somatotropin release-inhibiting factor)] is a cyclic peptide hormone existing as two isoforms and produced in the pancreas islet, GI tract and the central nervous system. Tetradecapeptide Somatostatin-14 (SRIF-14, the originally identified somatostatin) and the 28-amino acid Somatostatin-28 (SRIF-28) have similar biological activities but differ in their potency. Somatostatins regulate the endocrine system: they inhibit the release of growth hormone in contrast to Growth Hormone Factor (GRF), which stimulates the release of growth hormone. They also inhibit the release of prolactin and thyrotropin, peptide hormones from the pituitary gland and glucagon and insulin from the pancreas. They control the secretion of gut hormones and function as neurotransmitters.
Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
MW: 3148.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-418)

Supplier: Anaspec Inc

Description: This is a fluorescent (FAM)-labeled TAT peptide, Abs/Em = 494/521 nm.
Sequence: FAM-YGRKKRRQRRR
MW: 1918.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103010-170)

Supplier: Anaspec Inc

Description: Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7

Supplier: Anaspec Inc

Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-554)

Supplier: Anaspec Inc

Description: This peptide is a fragment of the JAG-1 protein. JAG-1 is Notch ligand, a peptide that is the most conspicuously expressed ligand in skin. JAG-1 induces epidermal maturation. Exposing submerged keratinocytes monolayers to JAG-1 with elevated calcium concentration produces stratification with loricrin expression and NF-κB activation.
Sequence: CDDYYYGFGCNKFCRPR
MW: 2107.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103006-236)

Supplier: Anaspec Inc

Description: Insulin secretory rate can be estimated from peripheral C-peptide concentrations in dogs. Plasma C-peptide concentrations during glucagon stimulation testing is variable in diabetic dogs and may represent dogs with type-1 and type-2 diabetes or more likely, differences in severity of beta-cell loss in dogs with type-1 diabetes.
Sequence: EVEDLQVRDVELAGAPGEGGLQPLALEGALQ
MW: 3174.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-964)

Supplier: Anaspec Inc

Description: This peptide is a synthetic peptide corresponding to amino acids 1-21 of human histone H3. It is trimethylated at lysine-4 with a C-terminal Gly-Gly linker followed by a biotinylated Lys. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2765.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-282)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. The importance of MMPs in tumor development and invasion as well as other diseases is well known. MMP-7 (matrilysin, PUMP-1) is proposed as a potential anti-cancer drug target.

Recombinant human MMP-7 was expressed in E.coli. The molecular mass of zymogen is approximately 28-kDa on SDS-PAGE and the active form is 19-kDa.
pro-MMP-7 can be fully activated by incubating with 1 mM APMA at 37°C for 1 hr. Its activity can be measured by FRET peptides. 5-10 ng of enzyme is sufficient for FRET-based assay.

Catalog Number: (103007-178)

Supplier: Anaspec Inc

Description: This C-terminal Exendin 4 Trp Cage variant is known as TC5b and can be used an for simulation studies of protein folding. This 20-residue construct is over 95% folded in water at physiological pH, and exhibits a tightly folded tertiary structure in solution. Trp Cage is a highly stable mini-protein fold. It consists of a short helix, a 3,10 helix and a C-terminal poly-proline that packs against a Trp in the alpha helix. It is known to fold within 4 nanoseconds. This stable fast-folding Trp Cage sequence displays special stabilizing features specific to this miniprotein.
Sequence: NLYIQWLKDGGPSSGRPPPS
MW: 2169.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:YGGFLRRIRPKLKWDNQ
MW:2147.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103002-986)

Supplier: Anaspec Inc

Description: This peptide is a universal Bombesin synthetic ligand, binding to all 3 bombesin receptors.
Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior. Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:yQWAV-(ß-A)-HF-Nle-NH2
MW:1298.5 Da
% peak area by HPLC:95
Storage condition:-20° C