You Searched For: Anaspec Inc

Catalog Number: (103006-122)

Supplier: Anaspec Inc

Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103011-014)

Supplier: Anaspec Inc

Description: Sulforhodamine 101 C2 maleimide is an excellent thiol-reactive reagent for protein modifications. It reacts with thiol compounds such as amino acid, peptides and proteins to give bright red fluorescent conjugates that have the identical fluorescent spectral properties of Texas Redâ-derived biopolymers, in particular, antibodies.

Catalog Number: (103008-048)

Supplier: Anaspec Inc

Description: This peptide is Histone 2B amino acid residues 21 to 41 with a C-terminal GG linker followed by a biotinylated lysine.
Sequence:AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)
MW:3024.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-232)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103011-050)

Supplier: Anaspec Inc

Description: DABCYL C2 maleimide is an excellent thiol-reactive building block for developing DABCYL-based FRET probes.

Catalog Number: (103010-566)

Supplier: Anaspec Inc

Description: The SensoLyte® Green Elastase Assay Kit is a FRET-based assay that detects elastase activity. The kit provides an elastin, natural substrate for elastases, labeled with 5-FAM fluorophore and QXL®520 quencher. Elastase-catalyzed hydrolysis yields brightly green fluorescence. Increase in fluorescence intensity is directly proportional to enzyme activity. The kit does not require any separation steps and can be used to continuously measure the kinetics of elastase.

Catalog Number: (103009-734)

Supplier: Anaspec Inc

Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (244-274) is a 31-amino acid long peptide derived from the Repeat 1 domain.
Sequence:Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
MW:3299.83 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-100)

Supplier: Anaspec Inc

Description: Mant-GTP is a fluorescent analog of GTP with Ex/Em = 355/448 nm. The fluorescence quantum yield of Mant fluorophore is 0.2 in water which increases significantly in nonpolar solvents or upon binding to most proteins. This highly environmental sensitive fluorescence of Mant makes Mant-GTP useful for directly detecting the nucleotide-protein interactions.

Catalog Number: (103008-102)

Supplier: Anaspec Inc

Description: Mant-ATP is a fluorescent analog of ATP with Ex/Em = 355/448 nm. The fluorescence quantum yield of Mant fluorophore is 0.2 in water which increases significantly in nonpolar solvents or upon binding to most proteins. This highly environmental sensitive fluorescence of Mant makes Mant-ATP useful for directly detecting the nucleotide-protein interactions.

Catalog Number: (103007-132)

Supplier: Anaspec Inc

Description: This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 2217.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-146)

Supplier: Anaspec Inc

Description: HCV protease is identified as an important drug-screening target.

Catalog Number: (103007-242)

Supplier: Anaspec Inc

Description: The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103010-360)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Catalog Number: (103010-962)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor594 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.