You Searched For: Anaspec Inc

Catalog Number: (103007-180)

Supplier: Anaspec Inc

Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-746)

Supplier: Anaspec Inc

Description: This peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: YGRKKRRQRRRCSTRIRRQL-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103002-738)

Supplier: Anaspec Inc

Description: A synthetic peptide substrate specific for AMP-activated protein kinase (AMPK).
Sequence:HMRSAMSGLHLVKRR-NH2
MW:1778.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-878)

Supplier: Anaspec Inc

Description: This peptide, derived from the BH3 domain of Bak (Flu-BakBH3), has been shown to have high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function.
Sequence:GQVGRQLAIIGDDINR
MW:1724.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-598)

Supplier: Anaspec Inc

Description: This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3335.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103006-542)

Supplier: Anaspec Inc

Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-098)

Supplier: Anaspec Inc

Description: This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-192)

Supplier: Anaspec Inc

Description: This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-536)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-420)

Supplier: Anaspec Inc

Description: Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases

Catalog Number: (103011-414)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Catalog Number: (103006-110)

Supplier: Anaspec Inc

Description: This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is acetylated in N-term.
Sequence:Ac-FFKNIVTPRTPPPSQGK-NH2
MW:1956 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102998-170)

Supplier: Anaspec Inc

Description: Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103005-328)

Supplier: Anaspec Inc

Description: This peptide, a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis and inflammed synovium in-vivo, and can be internalized into targeted cells.
Sequence:ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
MW:1145.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-672)

Supplier: Anaspec Inc

Description: This is a scrambled sequence of LL-37 used in control experiments.
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103011-356)

Supplier: Anaspec Inc

Description: Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavage