You Searched For: MilliporeSigma


2,186  results were found

SearchResultCount:"2186"

Sort Results

List View Easy View

Rate These Search Results

Supplier: MilliporeSigma
Description: 2992793
Catalog Number: (80600-352)
Supplier: MilliporeSigma
Description: A cell-permeable, photo-stable nitric oxide (NO) fluorescent indicator with a detection limit of ~10 nM.

Catalog Number: (80056-536)
Supplier: MilliporeSigma
Description: This antibody was developed against Recombinant Protein corresponding to amino acids: CEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPL.

Supplier: MilliporeSigma
Description: Inhibits protein tyrosine kinases, including autophosphorylation of epidermal growth factor receptor kinase (IC50=2.6µM)
Supplier: MilliporeSigma
Description: Native fibronectin purified from human plasma.
Catalog Number: (80051-614)
Supplier: MilliporeSigma
Description: Fibrinogen is a soluble plasma glycoprotein that is synthesized and secreted in the hepatic parenchymal cells.

Catalog Number: (80051-320)
Supplier: MilliporeSigma
Description: Inactive analog of genistein

Catalog Number: (80050-522)
Supplier: MilliporeSigma
Description: Complement C1q, is a native C1q complement component composed of 18 polypeptide chains consisting of three non-identical A, B, C subunits of 29, 26, and 19 kDa, respectively.

Catalog Number: (80050-868)
Supplier: MilliporeSigma
Description: A potent, cell-permeable, and reversible inhibitor of caspase-8 (FLICE, MACH, Mch5) and Granzyme B.

Catalog Number: (80051-180)
Supplier: MilliporeSigma
Description: Native guinea pig serum complement available in lyophilized form

Catalog Number: (80052-270)
Supplier: MilliporeSigma
Description: A cell-permeable inhibitor of caspase-1 (ICE; Interleukin-1[beta] Converting Enzyme) and caspase-4. The C-terminal YVAD-CHO sequence of this peptide is a highly specific, potent, and reversible inhibitor of caspase-1 (Ki=1nM). The N-terminal sequence (residues 1–16) corresponds to the hydrophobic region (h-region) of the signal peptide of the Kaposi fibroblast growth factor (K-FGF) and confers cell-permeability to the peptide.

Catalog Number: (80052-584)
Supplier: MilliporeSigma
Description: Potent stimulator of bone resorption and stimulator of nuclear phospholipase C. Induces nitric oxide synthase. Biological Activity: ED50=3–10pg/mL as measured in a cell proliferation assay.


Catalog Number: (80052-244)
Supplier: MilliporeSigma
Description: A synthetic amide of all-trans retinoic acid (RA) that displays reduced toxicity relative to RA while maintaining significant biological activity

Catalog Number: (80108-900)
Supplier: MilliporeSigma
Description: In 500mM NaCl, 150mM imidazole, 20mM Tris-HCl, 5mM DTT, 1mM EDTA, 10% glycerol, 0.1% CHAPS, pH 7.9

Catalog Number: (82603-578)
Supplier: MilliporeSigma
Description: The Apoptosis Activator VI, CD437/AHPN, also referenced under CAS 125316-60-1, modulates Apoptosis. This small molecule/inhibitor is primarily used for Cancer applications.

Catalog Number: (80053-428)
Supplier: MilliporeSigma
Description: 2992793

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
49 - 64 of 2,186
no targeter for Bottom