You Searched For: Z-Gly-Pro-Gly-Gly-Pro-Ala-OH


22,964  results were found

SearchResultCount:"22964"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Bachem Americas
Description: Sequence: Z-Gly-Pro-Gly-Gly-Pro-Ala-OH

Supplier: Bachem Americas
Description: GRADSP is used as negative control peptide for GRGDSP (H-7630).

Catalog Number: (H-3615.0001BA)
Supplier: Bachem Americas
Description: See also H-3974, H-Lys(4-nitro-Z)-pyrrolidide · HCl (N-1710) and H-Phe-pyrrolidide (E-3275).


Catalog Number: (A-1120.0005BA)
Supplier: Bachem Americas
Description: For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.


Supplier: Bachem Americas
Description: For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.

Catalog Number: (H-6134.0001BA)
Supplier: Bachem Americas
Description: PAR peptides (TRAP peptides and thrombin receptor-like peptides) activate the proteinase-activated receptors PAR-1 to PAR-4.


Supplier: Bachem Americas
Description: The FA-peptides M-1400 and M-1410 are common ACE substrates and thus filed in the corresponding product family. For our 3-(2-furyl)acryloyl-amino acids (FA-amino acids) and the labeling reagent FA-OSu (Q-1245), please see the Amino Acids section.

Supplier: Bachem Americas
Description: For Fmoc-dipeptides Fmoc-Xaa-Gly-OH and Fmoc-Xaa-Pro-OH, which can be used as building blocks in Fmoc-SPPS, please see also the subfamily 'Fmoc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. Pseudoproline dipeptides and isoacyl dipeptides can be found in this section as well. In case of a strong tendency towards diketopiperazine formation during Fmoc-SPPS, Fmoc-dipeptides have been coupled even at the risk of a some epimerization.

Supplier: Bachem Americas
Description: For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.

Catalog Number: (76485-660)
Supplier: AAT BIOQUEST INC
Description: DLDVPIPGRFDRRVpSVAAE is an excellent peptide substrate for calcineurin (Protein Phosphatase 2B, PP2B).

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (H-2672.0001BA)
Supplier: Bachem Americas
Description: CRGDFPASSC is a cyclic RGD-containing decapeptide which binds to the fibrinogen receptor on the platelet surface. This analog with Phe substituted for Ser at position 5 was found to be 3 times more active (IC₅₀ = 2.5 µM) as a platelet aggregation inhibitor than CRGDSPASSC.


Supplier: Bachem Americas
Description: GPenGRGDSPCA (cRGD), a cyclic RGD peptide has been used in the study of vascular wound response. GPenGRGDSPCA caused vasodilation when applied to isolated rat cremaster arterioles. The vasodilation is dependent on interaction of the soluble cRGD sequence with the αvβ3 integrin expressed by smooth muscle cells in the arteriolar wall.

Catalog Number: (103003-254)
Supplier: Anaspec Inc
Description: This is a the tandem repeat sequence of the MUC1 mucin core. MUC1 is a high molecular weight glycoprotein over-expressed by adenocarcinomas, and by different types of bladder tumors. It is also expressed by normal human epithelial cells.
Sequence:APDTRPAPG
MW:1484.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (H-7252.0500BA)
Supplier: Bachem Americas
Description: Stable isotope-labeled human ghrelin useful for pharmacokinetic/pharmacodynamic studies.


Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102996-268)
Supplier: Anaspec Inc
Description: The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 22,964
no targeter for Bottom