Print…

You Searched For: Violet+450+maleimide


24,615  results were found

Refine Results Sort by
SearchResultCount:"24615"

Sort Results

List View Easy View

Rate These Search Results

Product Image-76481-180

iFluor® 700, Maleimide

Catalog Number: (76481-180)
Supplier: AAT BIOQUEST INC
Description: AAT Bioquest's iFluor® dyes are optimized for labeling proteins, in particular, antibodies.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-RL200-306-382

Anti-6xHis Mouse Monoclonal Antibody (Biotin) [clone: 14A231]

Catalog Number: (RL200-306-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.
Product Image-RL200-303-382

Anti-6xHis Mouse Monoclonal Antibody (HRP (Horseradish Peroxidase)) [clone: 39A1413]

Catalog Number: (RL200-303-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide
Product Image-RL200-345-382

Anti-6xHis Mouse Monoclonal Antibody (DyLight® 800) [clone: 33D1.D2]

Catalog Number: (RL200-345-382)
Supplier: Rockland Immunochemical
Description: 100ug. Clone: 33D10.D2. Immunogen: This antibody was produced in mice by repeated immunizations with 6X His epitope tag peptide H-H-H-H-H-H conjugated to KLH using maleimide.
Product Image-95017-553

Amersham Cy3 and Cy5 Maleimide Mono-Reactive Dye 5-Packs, Cytiva

Supplier: Cytiva
Description: Mono-functional maleimides are particularly suitable for the selective labelling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides.

SDS Certificates

Product Image-76481-172

iFluor® 488, Maleimide

Catalog Number: (76481-172)
Supplier: AAT BIOQUEST INC
Description: Although FITC is still the most popular fluorescent labeling dye for preparing green fluorescent bioconjugates, there are certain limitations with FITC, such as severe photobleaching for microscope imaging and pH-sensitive fluorescence.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-77034-596

4-(N-Maleimidomethyl)cyclohexane-1-carboxylic acid 98%

Supplier: Ambeed
Description: 4-(N-Maleimidomethyl)cyclohexane-1-carboxylic acid 98%

New Product

Product Image-76481-174

iFluor® 555, Maleimide

Catalog Number: (76481-174)
Supplier: AAT BIOQUEST INC
Description: AAT Bioquest's iFluor® dyes are optimized for labeling proteins, in particular, antibodies.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-76774-906

5(6)-TAMRA 98% mix

Supplier: Ambeed
Description: 5(6)-TAMRA 98% mix

New Product

Product Image-PI22360

SMCC (N-Succinimidyl 4-(N-Maleimidomethyl)cyclohexanecarboxylate), Pierce™

Catalog Number: (PI22360)
Supplier: Invitrogen
Description: Thermo Scientific Pierce SMCC is a hetero-bifunctional crosslinker that contain N-hydroxysuccinimide (NHS) ester and maleimide groups that allow covalent conjugation of amine- and sulfhydryl-containing molecules. NHS esters react with primary amines at pH 7–9 to form amide bonds, while maleimides react with sulfhydryl groups at pH 6.5–7.5 to form stable thioether bonds. In aqueous solutions, NHS ester hydrolytic degradation is a competing reaction whose rate increases with pH. The maleimide group is more stable than the NHS-ester group, but will slowly hydrolyze and lose its reaction specificity for sulfhydryls at pH values > 7.5. For these reasons, conjugations with these crosslinkers are usually performed at pH 7.2–7.5, with the NHS ester (amine-targeted) reacted before or simultaneous with the maleimide (sulfhydryl-targeted) reaction.

SDS Certificates


Product Image-76481-288

iFluor® 790, Maleimide

Catalog Number: (76481-288)
Supplier: AAT BIOQUEST INC
Description: In vivo fluorescence imaging uses a sensitive camera to detect fluorescence emission from fluorophores in whole-body living small animals.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-89147-134

3,4-Di(1H-indol-3-yl)-1H-pyrrole-2,5-dione ≥98%

Supplier: Enzo Life Sciences
Description: PKC inhibitor

Product Image-MFLX06368-58

Masterflex® Transfer Tubing, High-Purity PFA-450, Avantor®

Supplier: VWR International
Description: Won't crack under stress.

Product Image-76481-182

iFluor® 750, Maleimide

Catalog Number: (76481-182)
Supplier: AAT BIOQUEST INC
Description: AAT Bioquest's iFluor® dyes are developed for labeling proteins, in particular, antibodies.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Image Unavailable-102999-616

Human Cys-beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103010-442

SMCC Activated R - PE

Catalog Number: (103010-442)
Supplier: Anaspec Inc
Description: R-Phycoerythrin (R-PE), a fluorescent protein from phycobiliprotein family, is isolated from red algae. SMCC Activated R-PE is chemically modified with SMCC. SMCC reacts with the primary amine on R-PE and introduces maleimide groups to R-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of R-PE with proteins. R-PE’s primary absorption peak is at 565 nm with secondary peaks at 496 and 545 nm. The broad excitation spectrum provides the advantage for multi-color immunofluorescent staining or cell sorting. R-PE and the closely related BPE are the most intensely fluorescent phycobiliproteins with orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. R-PE conjugates are widely used in applications such as flow cytometry, live cell staining, and immunofluorescent staining.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
417 - 432 of 24,615
no targeter for Bottom