Print…

You Searched For: \\u03B2-Chloropropiophenone


24,662  results were found

Refine Results Sort by
SearchResultCount:"24662"

Sort Results

List View Easy View

Rate These Search Results

Product Image-102148-982

Cyclophilin 40 Overexpression Lysate (Adult Normal), Novus Biologicals (NBL1-14648)

Catalog Number: (102148-982)
Supplier: Novus Biologicals
Description: Cyclophilin 40 Overexpression Lysate (Adult Normal)
Image Unavailable-103007-566

Human Beta-Amyloid (11-40), FAM (Carboxyfluorescein)

Catalog Number: (103007-566)
Supplier: Anaspec Inc
Description: This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-H-6694.0500BA

(Gly²²)-beta-Amyloid (1-40) Trifluoroacetate

Supplier: Bachem Americas
Description: The highly neurotoxic arctic mutant (E22G) of Aβ has been used to study the mechanisms underlying the formation of soluble and insoluble β-amyloid aggregates. As the wild-type Aβ, the arctic mutant preferably assembles in the presence of GM1 ganglioside.

SDS

Image Unavailable-H-6382.0500BA

(Pyr¹¹)-beta-Amyloid (11-40)

Supplier: Bachem Americas
Description: pEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, the N-terminally truncated isoform of the amyloid β-protein (Aβ) beginning with a pyroglutamate (Pyr) residue at position 11 was used in experiments studying the generality of fibrillogenesis-related helix formation. Comparing the fibrillogenesis kinetics of many of the most important clinically relevant amyloid β-protein alloforms it could be observed that among these peptides (Pyr¹¹)-amyloid β-protein (11-40) exhibited the greatest retardation of fibrillization rate.

Image Unavailable-103007-210

Human [Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-210)
Supplier: Anaspec Inc
Description: This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-77495-804

ORGANIC COMPOUND CAS# 2710162-40-4 1G

Supplier: AOBChem USA
Description: ORGANIC COMPOUND CAS# 2710162-40-4 1G

Image Unavailable-77485-910

ORGANIC COMPOUND CAS# 2969337-40-2 500MG

Catalog Number: (77485-910)
Supplier: AOBChem USA
Description: ORGANIC COMPOUND CAS# 2969337-40-2 500MG
Image Unavailable-10252-938

Anti-HSP 40-4/HDJ2/DNAJA1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10252-938)
Supplier: Bioss
Description: DnaJ-like proteins interact with HSP 70 molecular chaperones and function to facilitate protein folding and mitochondrial protein import. HSP 40-4, also known as HDJ2, is the human DnaJ homolog that functions as a co-chaperone with a cysteine-rich zinc finger domain. The cellular redox enzyme thioredoxin interacts with HSP 40-4, and oxidation and reduction reversibly regulate HSP 40-4 function in response to the changing redox states of the cell. The zinc finger domain of HSP 40-4 may act as a redox sensor of chaperone-mediated protein-folding machinery, since HSP 40-4 inactivation leads to the oxidation of cysteine thiols and a simultaneous release of coordinated zinc. Loss of the HSP 40-4 protein may be linked to severe defects in spermatogenesis that involve aberrant androgen signaling.
Product Image-97062-946

D-(+)-Glucose 40% (w/v) in aqueous solution, Ultra Pure Grade for biochemistry

Catalog Number: (97062-946)
Supplier: VWR
Description: D-(+)-Glucose 40% (w/v) in aqueous solution, Ultra Pure Grade for biochemistry

SDS Certificates


Image Unavailable-10207-950

Anti-Connexin 40/GJA5 Rabbit Polyclonal Antibody

Catalog Number: (10207-950)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Gap junction alpha-5 protein(GJA5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Product Image-76735-440

Human beta Amyloid 40 ELISA Kit

Catalog Number: (76735-440)
Supplier: ANTIBODIES.COM LLC
Description: Human beta Amyloid 40 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta Amyloid 40 in serum, plasma, tissue homogenates, and other biological fluids.
Image Unavailable-77496-002

ORGANIC COMPOUND CAS# 2918859-40-0 1G

Supplier: AOBChem USA
Description: ORGANIC COMPOUND CAS# 2918859-40-0 1G

Product Image-77976-157

Lipomed 40 mg/dL Aq. Ethanol Standard Solution, 40 mg/dL in Water

Catalog Number: (77976-157)
Supplier: LGC Standards
Description: Lipomed 40 mg/dL Aq. Ethanol Standard Solution, 40 mg/dL in Water

New Product


Image Unavailable-10796-764

(Pyr3)-beta-Amyloid (3-40) Trifluoroacetate

Supplier: Bachem Americas
Description: The pyroglutamate-modified amyloid-β peptides derived from Aβ40 (H-7422) and Aβ42 (H-4796) have gained considerable attention as potential key participants in the pathology of Alzheimer's disease (AD) due to their abundance in AD brain, high aggregation propensity, stability, and cellular toxicity. Aβ40 and 42 can be N-terminally truncated by action of cathepsin B. The cyclization of Glu³ is catalyzed by glutaminyl cyclase. Hence, inhibition of these enzymes could be a therapeutic approach to AD.

Product Image-76730-162

Mouse beta Amyloid 40 ELISA Kit

Catalog Number: (76730-162)
Supplier: ANTIBODIES.COM LLC
Description: Mouse beta Amyloid 40 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse beta Amyloid 40 in serum, plasma, tissue homogenates, and other biological fluids.
Product Image-BDH7690-1

Hydrogen peroxide (30 - 40%) 30% stabilised ACS analytical reagent, VWR Chemicals BDH®

Supplier: VWR International
Description: Hydrogen peroxide (30 - <lt/> 40%) 30% stabilised ACS analytical reagent, VWR Chemicals BDH®

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
465 - 480 of 24,662
no targeter for Bottom