Print…

You Searched For: Potassium+selenate


24,662  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"24662"

Rate These Search Results

Product Image-102148-982

Cyclophilin 40 Overexpression Lysate (Adult Normal), Novus Biologicals (NBL1-14648)

Description: Cyclophilin 40 Overexpression Lysate (Adult Normal)
Catalog Number: 102148-982
Supplier: Novus Biologicals
Image Unavailable-103007-566

Human Beta-Amyloid (11-40), FAM (Carboxyfluorescein)

Description: This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-566
Supplier: Anaspec Inc
Image Unavailable-H-6694.0500BA

(Gly²²)-beta-Amyloid (1-40) Trifluoroacetate

Description: The highly neurotoxic arctic mutant (E22G) of Aβ has been used to study the mechanisms underlying the formation of soluble and insoluble β-amyloid aggregates. As the wild-type Aβ, the arctic mutant preferably assembles in the presence of GM1 ganglioside.
Catalog Number: H-6694.0500BA
Supplier: Bachem Americas

SDS


Image Unavailable-H-6382.0500BA

(Pyr¹¹)-beta-Amyloid (11-40)

Description: pEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, the N-terminally truncated isoform of the amyloid β-protein (Aβ) beginning with a pyroglutamate (Pyr) residue at position 11 was used in experiments studying the generality of fibrillogenesis-related helix formation. Comparing the fibrillogenesis kinetics of many of the most important clinically relevant amyloid β-protein alloforms it could be observed that among these peptides (Pyr¹¹)-amyloid β-protein (11-40) exhibited the greatest retardation of fibrillization rate.
Catalog Number: H-6382.0500BA
Supplier: Bachem Americas
Image Unavailable-103007-210

Human [Asn23]-beta-Amyloid (1-40)

Description: This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-210
Supplier: Anaspec Inc
Image Unavailable-77495-804

ORGANIC COMPOUND CAS# 2710162-40-4 1G

Description: ORGANIC COMPOUND CAS# 2710162-40-4 1G
Catalog Number: 77495-804
Supplier: AOBChem USA
Image Unavailable-77485-910

ORGANIC COMPOUND CAS# 2969337-40-2 500MG

Description: ORGANIC COMPOUND CAS# 2969337-40-2 500MG
Catalog Number: 77485-910
Supplier: AOBChem USA
Image Unavailable-10252-938

Anti-HSP 40-4/HDJ2/DNAJA1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Description: DnaJ-like proteins interact with HSP 70 molecular chaperones and function to facilitate protein folding and mitochondrial protein import. HSP 40-4, also known as HDJ2, is the human DnaJ homolog that functions as a co-chaperone with a cysteine-rich zinc finger domain. The cellular redox enzyme thioredoxin interacts with HSP 40-4, and oxidation and reduction reversibly regulate HSP 40-4 function in response to the changing redox states of the cell. The zinc finger domain of HSP 40-4 may act as a redox sensor of chaperone-mediated protein-folding machinery, since HSP 40-4 inactivation leads to the oxidation of cysteine thiols and a simultaneous release of coordinated zinc. Loss of the HSP 40-4 protein may be linked to severe defects in spermatogenesis that involve aberrant androgen signaling.
Catalog Number: 10252-938
Supplier: Bioss
Product Image-97062-946

D-(+)-Glucose 40% (w/v) in aqueous solution, Ultra Pure Grade for biochemistry

Description: D-(+)-Glucose 40% (w/v) in aqueous solution, Ultra Pure Grade for biochemistry
Catalog Number: 97062-946
Supplier: VWR

SDS Certificates


Image Unavailable-10207-950

Anti-Connexin 40/GJA5 Rabbit Polyclonal Antibody

Description: Rabbit IgG polyclonal antibody for Gap junction alpha-5 protein(GJA5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number: 10207-950
Supplier: Boster Biological Technology
Product Image-76735-440

Human beta Amyloid 40 ELISA Kit

Description: Human beta Amyloid 40 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta Amyloid 40 in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number: 76735-440
Supplier: ANTIBODIES.COM LLC
Image Unavailable-77496-002

ORGANIC COMPOUND CAS# 2918859-40-0 1G

Description: ORGANIC COMPOUND CAS# 2918859-40-0 1G
Catalog Number: 77496-002
Supplier: AOBChem USA
Product Image-77976-157

Lipomed 40 mg/dL Aq. Ethanol Standard Solution, 40 mg/dL in Water

Description: Lipomed 40 mg/dL Aq. Ethanol Standard Solution, 40 mg/dL in Water
Catalog Number: 77976-157
Supplier: LGC Standards

New Product


Image Unavailable-10796-764

(Pyr3)-beta-Amyloid (3-40) Trifluoroacetate

Description: The pyroglutamate-modified amyloid-β peptides derived from Aβ40 (H-7422) and Aβ42 (H-4796) have gained considerable attention as potential key participants in the pathology of Alzheimer's disease (AD) due to their abundance in AD brain, high aggregation propensity, stability, and cellular toxicity. Aβ40 and 42 can be N-terminally truncated by action of cathepsin B. The cyclization of Glu³ is catalyzed by glutaminyl cyclase. Hence, inhibition of these enzymes could be a therapeutic approach to AD.
Catalog Number: 10796-764
Supplier: Bachem Americas
Product Image-76730-162

Mouse beta Amyloid 40 ELISA Kit

Description: Mouse beta Amyloid 40 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse beta Amyloid 40 in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number: 76730-162
Supplier: ANTIBODIES.COM LLC
Product Image-BDH7690-1

Hydrogen peroxide (30 - 40%) 30% stabilised ACS analytical reagent, VWR Chemicals BDH®

Description: Hydrogen peroxide (30 - <lt/> 40%) 30% stabilised ACS analytical reagent, VWR Chemicals BDH®
Catalog Number: BDH7690-1
Supplier: VWR International

SDS Certificates


529 - 544 of 24,662