You Searched For: L-Lysine-L-glutamate

Supplier: Spectrum Chemicals

Description: L-Lysine L-Glutamate Salt is a glutamate salt of L-lysine. L-Lysine is an essential amino acid in human. It is metabolized to acetyl-CoA. It is widely used as an ingredient in infusion.

Supplier: Matrix Scientific

Description: MF=C11H23N3O6 MW=293.32 CAS=5408-52-6 MDL=MFCD00038974 10G

Supplier: Ambeed

Description: (S)-2,6-Diaminohexanoic acid (S)-2-aminopentanedioic acid salt, Purity: 95%, CAS number: 5408-52-6, Appearance: White to off-white solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 10G

Catalog Number: (10254-654)

Supplier: Bioss

Description: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.

Catalog Number: (10254-656)

Supplier: Bioss

Description: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.

Catalog Number: (103007-216)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (10254-658)

Supplier: Bioss

Description: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.

Catalog Number: (10256-686)

Supplier: Bioss

Description: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.

Catalog Number: (10254-650)

Supplier: Bioss

Description: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.

Catalog Number: (10254-652)

Supplier: Bioss

Description: Contributes to degradation of proteins cross-linked by transglutaminases. Degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. Catalyzes the formation of 5-oxoproline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.

Catalog Number: (103007-214)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (75789-132)

Supplier: Prosci

Description: Gamma-Glutamylaminecyclotransferase is an enzyme that converts gamma-glutamylamines to free amines and 5-oxoproline which belongs to the gamma-glutamylcyclotransferase family. It shows high activity toward gamma-glutamyl-epsilon-lysine, derived from the breakdown of fibrin and contributes to degradation of proteins cross-linked by transglutaminases. It degrades the cross-link between a lysine and a glutamic acid residue from two proteins that have been cross-linked by transglutaminases. This protein adopts the newly identified cyclotransferase fold, observed in Gamma-Glutamylcyclotransferase, an enzyme with activity toward gamma-glutamyl-alpha-amino acids.

Supplier: Enzo Life Sciences

Description: Recommended Applications: ELISA, Flow Cytometry, ICC, IF, IHC (PS), IP, WB, Electron microscopy

Catalog Number: (77439-950)

Supplier: Bioss

Description: The GCLC gene consists of 16 exons and encodes the 636 amino acid protein g-GCSc (g-glutamylcysteine synthetase heavy subunit), also designated g-L-glutamate-L-cysteine ligase catalytic subunit (GLCLC). g-GCSc is expressed in hemocytes, brain, liver and kidney. g-GCSc associates with a regulatory or modifier subunit, g-GCSm (g-glutamylcysteine synthetase light subunit), to form a heterodimer, g-GCS. g-GCS is the first enzyme involved and the rate determining step in glutathione biosynthesis. Oxidants, cadium and methyl mercury upregulate the transcription of g-GCS. H2O2 regulation depends on the Yap1 protein and the presence of glutamate, glutamine and lysine. Cadium regulates transcription through proteins Met-4, Met-31 and Met-32. Cbf1, a DNA binding protein, inhibits transcription of g-GCS. Chemopreventive compounds cause increased levels of g-GCSc in kidney tissues, which may protect against chemically induced carcinogenesis. A His370Leu amino acid change in g-GCSc causes deficiencies in activity which are responsible for hemolytic anemia and low red blood cell glutathione levels. Defects in GCLC are the cause of hemolytic anemia.

New Product

Catalog Number: (103283-554)

Supplier: Novus Biologicals

Description: The LEKR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LEKR1. This antibody reacts with human. The LEKR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.

Catalog Number: (10782-116)

Supplier: Biosensis

Description: High-mobility group proteins were named originally since they are abundand relatively low molecular weight proteins which run quickly on SDS-PAGE gels. High-mobility group protein box 1 (HMGB1, Amphoterin) is one of these. The "bx" in the name refers to the so-called high mobility group (HMG) box, a compact domain involved in DNA binding and protein-protein interactions. the HMGB1 molecule has two of these HMG domains. The protein is alslo called amphoterin, this name being derived from the presence of two highly charged regions in the molecule, a relatively neutrally charged N-terminus and a very negatively charged C-terminus. In fact the molecule is very unusually charged throughout, the human sequence consisting of 16.7% Glutamic acid, 9.3% Aspartic acid, 20% lysine and 9.3% Arginine. HMGB1 can bind Toll like receptor 4 (TLR4) and the Receptor for Advanced Glycation End products (RAGE). TLRs are components of the innate immune system, first recognized as a family of receptors which recognize "Pathogen Associated Molecular Pattern molecules (PAMPs). PAMPs are common components of bacteria and when TLRs bind these a strong inflammatory response is activated. More recently it has been recognized that TLRs can also be activated by Damage Associated Molecular Pattern molecules (DAMPs), which are endogenous substances released from damaged and diseased cells which also bind to TLR family receptors and also activate inflammation. HMGB1 is such a DAMP, binding to TLR4, and much evidence suggests that HMGB1 is a strong activator of inflammation. Interestingly, HMGB1 is released by necrotic cells but not by apoptotic cells (1).