Print…

You Searched For: Gold+tin+eutectic+alloy+(80:20+wt%)


97,476  results were found

Refine Results Sort by
SearchResultCount:"97476"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-AA42944-30

Stainless steel (Fe:Cr:Ni:Mo; 67.5:17:13:2.5 wt%), powder -40+80 mesh Type 316

Supplier: Thermo Scientific Chemicals
Description: -40+80 mesh, Type 316.WARNING: Irritates lungs, eyes, skin,250g,1kg.

SDS Certificates

Image Unavailable-ABCA_AB269935-10ML

Gold, nanoparticles 20 nm 1 OD

Supplier: Abcam
Description: 20nm Gold Nanoparticles (1 OD) is an aqueous suspension of spherical metallic nanoparticles.

New Product

Image Unavailable-ABCA_AB269937-100M

Gold 20 nm 15 OD

Supplier: Abcam
Description: 20nm Gold Nanoparticles (15 OD) is an aqueous suspension of spherical metallic nanoparticles.

New Product

Product Image-77697-454

Gold AA Standard: Au @ 1000 µg/mL in 20% HCl, VHG, LGC Standards

Supplier: LGC Standards
Description: Gold Standard, Gold AA Standard: Au @ 1000 µg/mL in 20% HCl, 1000 µg/mL, VHG, Application: ICP-MS standards

New Product

Image Unavailable-77680-847

Gold ≥99.99%, disk, as roll, Diameter 20 mm

Supplier: GOODFELLOW CORPORATION
Description: Gold ≥99.99%, disk, as roll, Diameter 20 mm

New Product

Image Unavailable-ABCA_AB269936-10ML

Gold, nanoparticles 20 nm 10 OD

Supplier: Abcam
Description: 20nm Gold Nanoparticles (10 OD) is an aqueous suspension of spherical metallic nanoparticles.

New Product

Image Unavailable-AAJ67386-XF

Gold carboxy-functionalized, 3kDa PEGylated, nanoparticles 20 nm OD50 (Abs. 524 nm)

Supplier: Thermo Scientific Chemicals
Description: Gold carboxy-functionalized, 3kDa PEGylated, nanoparticles 20 nm OD50 (Abs. 524 nm)

SDS

Product Image-89234-882

Accessories for SP Bel-Art Grande Desiccator Cabinets, Bel-Art Products, a part of SP

Catalog Number: (89234-882)
Supplier: Bel-Art Products, a Part of SP
Description: Scienceware, pair, removable, Grande Desiccator can hold up to 7 shelves, pull-out, perforated acrylic. max wt per shelf: 10lbs (4.5kg) Dimensions: 50.8W x 53D x 6.7cmH (20 x 20-7/8 x 2-5/8in), pk 2
Image Unavailable-AAJ67465-AMI

Gold amine-functionalized, 3kDa PEGylated, nanoparticles 20 nm OD50 (Abs. 524 nm)

Supplier: Thermo Scientific Chemicals
Description: Gold amine-functionalized, 3kDa PEGylated, nanoparticles 20 nm OD50 (Abs. 524 nm)

SDS

Image Unavailable-AA45822-03

Gold ≥99.95% (metals basis), nanopowder APS 20-25 nm

Catalog Number: (AA45822-03)
Supplier: Thermo Scientific Chemicals

SDS Certificates


Product Image-76360-424

Polytron® 20 mm Tablet Grinder Generator, PT-DA 20/2XEC, Kinematica

Supplier: Kinematica
Description: X-design for hard and brittle pills and gel caps. A special geometry designed for dispersing tablets and pills or for preventing suppositories from clogging. Dispersing generators are made from high-alloy stainless steel 316L, electropolished, Ra≤1.6 μm as standard.

Small Business Enterprise

Image Unavailable-103007-208

Human [Gln22]-beta-Amyloid (1-42)

Catalog Number: (103007-208)
Supplier: Anaspec Inc
Description: This peptide is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide. The E22Q 'Dutch' mutant, also known as HCHWA-D, is caused by a point mutation in the beta-Amyloid encoding gene, with Glu replaced by Gln at position 22. Dutch E22Q mutation in beta-Amyloid causes familial cerebrovascular amyloidosis with abundant diffused amyloid plaque deposits. E22Q mutant and WT peptides are both stable in 'collapsed coil' conformations. The E22Q fibrils are more toxic for vascular cells than the WT fibrils.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-76360-442

Polytron® Generator, PT-DA/2WEC-E192, Kinematica

Supplier: Kinematica
Description: W-design for fibrous/stringy materials. Special design to prevent the teeth clogging. Dispersing generators are made from high-alloy stainless steel 316L, electropolished, Ra≤1.6 μm as standard.

Small Business Enterprise

Image Unavailable-10785-294

Accessories for PrimaCell™, Human Colorectal Epithelial Cell Culture Kit, CHI Scientific

Supplier: CHI Scientific
Description: Human Colon OptiTDS* kit, PrimaCell* Tissue Dissociation System, A mixture of collagenase I, collagenase III, collagenase IV, collagenase, and trypsin, Stability: package should be stored at -20 degree Celcius, and effective up to 4 months

Product Image-63042-522

Tweezers, Angulated Wire Cutting, Excelta Corp®

Supplier: Excelta
Description: These cutting tweezers are designed for cutting of small wires or flashing under magnification.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Image Unavailable-TCP0758-100MG

Phosphoenolpyruvic acid monocyclohexylammonium salt ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 10526-80-4
MDL Number: MFCD00036375
Molecular Formula: C3H5O6P
Molecular Weight: 267.22
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Storage Temperature: 0-10°C

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240 of 97,476
no targeter for Bottom