Print…

You Searched For: GRAYBAR+ELECTRIC+CO+INC+CP


81,386  results were found

Refine Results Sort by
SearchResultCount:"81386"

Sort Results

List View Easy View

Rate These Search Results

Product Image-76636-722

2D Coded Sample Storage Tubes, 0.8 ml, 96-format, External Thread, Azenta Life Sciences

Supplier: AZENTA US, INC
Description: Azenta Life Sciences 2D coded tubes provide a lifelong and secure chain of custody for samples in biobanks, compound libraries and a broad range of biological and chemical stores, including cryogenic storage.

Certificates

Product Image-76636-832

2D Coded Sample Storage Tubes, 0.2 ml, 240-format, External Thread, Azenta Life Sciences

Supplier: AZENTA US, INC
Description: Azenta Life Sciences 2D coded tubes provide a lifelong and secure chain of custody for samples in biobanks, compound libraries and a broad range of biological and chemical stores, including cryogenic storage.

Certificates

Product Image-76636-948

Tri-Coded Sample Storage Tubes, 0.65 ml, 24-format, External Thread, Azenta Life Sciences

Supplier: AZENTA US, INC
Description: Azenta Life Sciences tri-coded tubes offer unequaled sample audit traceability, enabling sample tracking and data sharing between multiple users, labs, locations and automation capabilities.

Certificates

Product Image-470136-062

Snap Circuits® 300 Experiments

Catalog Number: (470136-062)
Supplier: Elenco Electronics
Description: Snap Circuits® makes learning electronics easy and fun! Just follow the colorful pictures in our manual and build exciting projects such as AM radios; burglar alarms; doorbells and much more! You can even play electronic games with your friends. All parts are mounted on plastic modules and snap together with ease. Enjoy hours of educational fun while learning about electronics. No tools required. Includes Projects 1-305 manuals (includes all of the SC100 projects and 200 new ones!).
Product Image-470006-532

Discover Electric Circuits Kits

Catalog Number: (470006-532)
Supplier: Avantor
Description: Introduce the concept of a simple electric circuit and show that a wire can carry electricity and how a switch can start and stop the current flow.
Product Image-MFLX75219-20

Masterflex® FDA Compliant Sanitary Drum Pumps, Avantor®

Supplier: VWR International
Description: Capable of pumping fluids with viscosities up to 1000 cps.

Image Unavailable-100210-632

Dodecacarbonyltetracobalt ≥98%

Catalog Number: (100210-632)
Supplier: Strem Chemicals Inc
Description: Metal Carbonyls
Image Unavailable-100200-918

Cobalt ≥99.9%, foil

Supplier: Strem Chemicals Inc
Description: CAS #: 7440-48-4. Size: 1pc.

Product Image-76636-918

Dual-Coded Sample Storage Tubes, 0.3 ml, 96-format, Internal Thread, Azenta Life Sciences

Supplier: AZENTA US, INC
Description: Azenta Life Sciences dual-coded tubes feature a 2D-code and Human Readable Number (HRN) on the tube base, allowing compatibility with low throughput manual workflows, semi-automated workflows or fully automated workflows on integrated platforms.

Certificates

Image Unavailable-100202-656

Cobalt ≥99.9%, pieces

Supplier: Strem Chemicals Inc
Description: CAS #: 7440-48-4. Size: 500g.

Product Image-30180-032

VWR® Square/Octagonal Media Bottles, Polycarbonate

Catalog Number: (30180-032)
Supplier: VWR International
Description: VWR® polycarbonate resin is an amorphous engineering thermoplastic, characterized by outstanding mechanical, optical, electrical, and thermal properties.

Certificates


Image Unavailable-100205-058

Cobalt ≥99.8%, Powder

Supplier: Strem Chemicals Inc
Description: CAS #: 7440-48-4. Size: 250g.

Image Unavailable-102996-312

Human Pancreatic Polypeptide, AnaSpec

Supplier: Anaspec Inc
Description: Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Product Image-470039-678

Color LEDs

Supplier: Avantor
Description: Every color of the rainbow available!

Image Unavailable-100200-722

Lithium carbonate ≥99%

Supplier: Strem Chemicals Inc
Description: CAS #: 554-13-2. Size: 250g.

Product Image-10217-230

Drum Pumps for Combustible Liquids, Bürkle

Supplier: BURKLE INC
Description: Drum Pumps for Combustible Liquids made of Stainless steel V2A (1.4301) / AISI 304 available with rigid discharge tube or flexible 1.2 m PTFE/stainless steel discharge hose with ball valve made of stainless steel

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
369 - 384 of 81,386
no targeter for Bottom