You Searched For: 6-FAM+Alkyne


646  results were found

SearchResultCount:"646"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Anaspec Inc
Description: Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:5-FAM-LRRASLG
MW:1130.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:5-FAM-KRREILSRRPSYR
MW:2075.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-404)
Supplier: Anaspec Inc
Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes. This peptide is a fluorescent (FAM)-labeled Substance P, Abs/Em = 494/521 nm.
Sequence:FAM-RPKPQQFFGLM-NH2
MW:1706 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102996-804)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103003-074)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (76480-928)
Supplier: AAT BIOQUEST INC
Description: Texas Red® alkyne is an excellent azide-reactive fluorescent reagent for labeling alkyne-containing biological molecules through the well known click chemistry.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (103006-412)
Supplier: Anaspec Inc
Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This is a fluorescent (FAM)-labeled cell permeable peptide, Abs/Em = 494/521 nm.
Sequence:FAM-RRRRRRRRR
MW:1782 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-676)
Supplier: Anaspec Inc
Description: This is antimicrobial peptide LL-37 with a 6-carbon linker (LC) conjugated to 5-FAM suitable for cell culture and activity studies.
Sequence: 5 - FAM - LC - LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
MW: 4964.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Catalog Number: (103007-840)
Supplier: Anaspec Inc
Description: This peptide is Srctide with an N-terminal 5-FAM (Ex/Em=494/521 nm) label. Srctide is a substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR).
Sequence:5-FAM-GEEPLYWSFPAKKK-NH2
MW:2037.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Biotium
Description: CF® Dye alkynes react with azide groups via copper-catalyzed bioorthogonal cycloaddition. Can be used to fluorescently detect or label azide groups on target molecules. CF® Dye alkynes can also be used as building blocks to form fluorescent polymers.

SDS

Catalog Number: (103007-756)
Supplier: Anaspec Inc
Description: This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a FAM (Abs/Em = 494/521 nm) labeled lysine.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2854.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-732)
Supplier: Anaspec Inc
Description: This FAM labeled peptide (Abs/Em = 494/521 nm) can be used as a substrate for 5-AMP-activated protein kinase (AMPK) in in vitro kinase assays.
Sequence:5-FAM-HMRSAMSGLHLVKRR
MW:2137.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-418)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled TAT peptide, Abs/Em = 494/521 nm.
Sequence: FAM-YGRKKRRQRRR
MW: 1918.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103007-770)
Supplier: Anaspec Inc
Description: This is a FAM labeled peptide substrate (Abs/Em = 494/521 nm) for C-terminal Src kinase (Csk) and many other kinases such as Axl, cKit, ERBB4, Fes, Flt3, IGF-1 R, MET, MUSK, PYK2, Ret, TIE2, TrkA, VEGF-R1 and VEGF-R2.
Sequence:5-FAM-KKKKEEIYFFFG-NH2
MW:1921.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (10796-710)
Supplier: Bachem Americas
Description: 5-FAM-Amylin (human), Trifluoroacetate salt, Molecular Formula: C186H271N51O61S2, CAS Registry Number [1678414-71-5] net, Source Synthetic, , Storage Conditions: -20 +/- 5 degree Celcius


Catalog Number: (103007-616)
Supplier: Anaspec Inc
Description: PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay.
Sequence: 5-FAM-(β-A)-(β-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
MW: 1784.3Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
129 - 144 of 646
no targeter for Bottom