Human GIP (1-42)
Supplier: Anaspec Inc
GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4983.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Learn more

About VWR
Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...