Human Beta-Amyloid (42-1)

Supplier: Anaspec Inc

AS-27275 AS-27276 AS-27276-01
103000-620EA 695.69 USD
103000-620 103000-622 103000-624
Human Beta-Amyloid (42-1)
Proteins and Peptides

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.
Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR