You Searched For: 3-Chloro-2-fluoro-4-methoxyphenylboronic acid pinacol ester


1,192  results were found

SearchResultCount:"1192"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103008-018)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 di-methylated at Lys-4.
Sequence:ART-K(Me2)-QTARKS
MW:1174.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-726)
Supplier: Anaspec Inc
Description: This is a cyclic RGDfC sequence, an integrin avb3-affinity peptide.
Sequence:Cyclo(-RGDfC)
MW:578.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: Tetramethylrhodamine (TMR) is one of the fluorophores most often used for preparing peptide, protein, nucleotide and nucleic acid conjugates, especially fluorescent antibodies and avidin derivatives used in immunochemistry. TMR dyes have been widely used as acceptors for FAM fluorophores in a variety of FRET studies. The succinimidyl esters of 5-TAMRA, 6-TAMRA or the mixed isomers are the primary labeling reagents.

Supplier: Anaspec Inc
Description: This cyclic peptide is a potent vasodilator. It is more powerful than the linear GRGDSP in changing the vascular tone of arterioles isolated from rat cremaster muscle.
Sequence:GRGDSP, N to C cyclized
MW:569.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc
Description: This is one of the predominant amyloid peptide structures deposited in human brain of Alzheimer’s disease and Down’s syndrome patients.Sequence: Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4309.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-830)
Supplier: Anaspec Inc
Description: This is a bcl-2 binding peptide. This peptide is derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165.
Sequence:LWAAQRYGRELRRMSDEFEGSFKGL
MW:3003.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102999-764)
Supplier: Anaspec Inc
Description: This ANP (1-28) peptide hormone has been biotinylated at the N-terminus and can be used in conjugation experiments. ANP (1-28) constitutes the first 28 amino acids of the ANP synthesized in the heart of different vertebrates. It plays an important role in the regulation of blood pressure and natriuresis/diuresis. Residues Phe8, Arg14 and the C-terminal sequence of ANP are known to bind to human NPR-A (Natriuretic peptide receptor type A).
Sequence:Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
MW:3308.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (102999-786)
Supplier: Anaspec Inc
Description: Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.
Sequence:KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
MW:3834.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103005-822)
Supplier: Anaspec Inc
Description: Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (102996-266)
Supplier: Anaspec Inc
Description: PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
MW: 3147.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103007-364)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 38 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4035.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103006-336)
Supplier: Anaspec Inc
Description: [Ala13]-Apelin-13 is an Apelin-13 antagonist evidenced from its blood pressure lowering reversal effects in hypertensive rats.
Sequence:QRPRLSHKGPMPA
MW:1474.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103010-400)
Supplier: Anaspec Inc
Description: West Nile virus (WNV) causes severe neurological disease and fatalities in both human and animal hosts


Catalog Number: (103007-274)
Supplier: Anaspec Inc
Description: This peptide belongs to the Bcl-2 family of proteins. Noxa gene encodes a Bcl-2 homology 3 (BH3)-only member of this family; it contains the BH3 region, not other BH domains. When ectopically expressed, Noxa undergoes BH3 motif-dependent localization to mitochondria, it interacts with anti-apoptotic Bcl-2 family members resulting in the activation of caspase-9.
Sequence:PAELEVECATQLRRFGDKLNFRQKLL
MW:3075.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-470)
Supplier: Anaspec Inc
Description: This peptide is Protegrin-1 (PG-1) with a modified C-terminal amide. PG-1 is an 18-amino-acid beta-hairpin antimicrobial peptide found in porcine leukocytes and belongs to the cathelicidin family. PG-1 exhibits broad-spectrum activity unaffected by extracellular NaCl concentrations and is capable of inactivating numerous bacterial strains, Candida albicans, and some enveloped viruses. The efficacy is strongly dependent upon the existence of two disulfide bonds that stabilize the beta-sheet structure.


Catalog Number: (103006-416)
Supplier: Anaspec Inc
Description: This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
49 - 64 of 1,192
no targeter for Bottom