You Searched For: Alere


0  results were found

Sort Results

List View Easy View
SearchResultCount:"0"
Description: Paragon Scientific Density 40 °C (Nominal: 0.7934 g/ml @ 40 °C)
Catalog Number: 77975-706
Supplier: LGC Standards

New Product


Description: Lithium aluminum hydride 4.0 M in diethyl ether, AcroSeal®
Catalog Number: TS199511000
Supplier: Thermo Scientific Chemicals

New Product


Description: 2-Mercaptopyridine-N-oxide sodium salt 40% (w/w) in aqueous solution
Catalog Number: TS257740010
Supplier: Thermo Scientific Chemicals

New Product


Description: Sodium deuteroxide 40% (w/w) in D₂O for NMR spectroscopy (D₂O 99+ atom%D)
Catalog Number: TS175470500
Supplier: Thermo Scientific Chemicals

New Product


Description: ClearPoint™ beta-Amyloid (1-40) is a heavy-isotope labeled peptide. All the Arginine and Lysines have universally labeled 13C and 15N.
Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV [R*=R(U-13C6, U-15N4) & K*=K(U-13C6, U-15N2)]
Molecular Weight: 4355.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-698
Supplier: Anaspec Inc


Description: The Dutch mutation (E22Q) of amyloid β-peptide aggregates more readily than the wild-type peptide and the resulting fibrils show increased neurotoxicity. The mutant peptide E22Q induced apoptosis of cerebral endothelial cells at a concentration of 25 μm, whereas WT Aβ 1-40 and the Italian mutant E22K (H-6698) showed no effect.
Catalog Number: H-6696.0500BA
Supplier: Bachem Americas

SDS


Description: Ethoxyacetylene 40% (w/w) in hexanes
Catalog Number: TS30739-0010
Supplier: Thermo Scientific Chemicals


Description: Sodium borohydride 12% in sodium hydroxide solution 40%
Catalog Number: TS389932500
Supplier: Thermo Scientific Chemicals

New Product


Description: Glyoxal, 40 Percent in Water is used as a crosslinker for starch-based products in the coated paper and textile industry, as well as, being used as a solubilizer and crosslinker in polymer chemistry
Catalog Number: 700003-704
Supplier: Spectrum Chemicals

Description: Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103005-822
Supplier: Anaspec Inc


Description: 4-(Dicyclohexylphosphino)-N,N-dimethylaniline 98%
Catalog Number: 76993-426
Supplier: Ambeed

New Product


Description: Ammonium hexafluorophosphate 99%, pure
Catalog Number: TS20232-0050
Supplier: Thermo Scientific Chemicals


Description: Phosphine
Catalog Number: 100198-642
Supplier: Strem Chemicals Inc


Description: 5-(Diphenylphosphanyl)-2-(trifluoromethyl)pyridine 98%
Catalog Number: 77597-640
Supplier: Ambeed

New Product


Description: 4-(Dimethylamino)phenyldiphenylphosphine 97%
Catalog Number: 76871-670
Supplier: Ambeed


Description: Cyanomethylenetributylphosphorane 94%
Catalog Number: 77406-462
Supplier: APOLLO SCIENTIFIC