Result Type

Product Results Site Content PDF Documents Videos

Refine Result

Sort by

You Searched For: Alere

0 results were found

Refine Results Sort by

Sort Results

List View Easy View

Compare(0) Clear

Rate These Search Results

Paragon Scientific Density 40 °C (Nominal: 0.7934 g/ml @ 40 °C)

Description: Paragon Scientific Density 40 °C (Nominal: 0.7934 g/ml @ 40 °C)

Catalog Number: 77975-706

Supplier: LGC Standards

New Product Sale

Clearance

Lithium aluminum hydride 4.0 M in diethyl ether, AcroSeal®

Description: Lithium aluminum hydride 4.0 M in diethyl ether, AcroSeal®

Catalog Number: TS199511000

Supplier: Thermo Scientific Chemicals

New Product Sale

Clearance

2-Mercaptopyridine-N-oxide sodium salt 40% (w/w) in aqueous solution

Description: 2-Mercaptopyridine-N-oxide sodium salt 40% (w/w) in aqueous solution

Catalog Number: TS257740010

Supplier: Thermo Scientific Chemicals

New Product Sale

Clearance

Sodium deuteroxide 40% (w/w) in D₂O for NMR spectroscopy (D₂O 99+ atom%D)

Description: Sodium deuteroxide 40% (w/w) in D₂O for NMR spectroscopy (D₂O 99+ atom%D)

Catalog Number: TS175470500

Supplier: Thermo Scientific Chemicals

New Product Sale

Clearance

ClearPoint™ Human Beta-Amyloid (1-40)

Description: ClearPoint™ beta-Amyloid (1-40) is a heavy-isotope labeled peptide. All the Arginine and Lysines have universally labeled 13C and 15N.
Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV [R*=R(U-13C6, U-15N4) & K*=K(U-13C6, U-15N2)]
Molecular Weight: 4355.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-698

Supplier: Anaspec Inc

Sale

Clearance

(Gln²²)-beta-Amyloid (1-40) Trifluoroacetate

Description: The Dutch mutation (E22Q) of amyloid β-peptide aggregates more readily than the wild-type peptide and the resulting fibrils show increased neurotoxicity. The mutant peptide E22Q induced apoptosis of cerebral endothelial cells at a concentration of 25 μm, whereas WT Aβ 1-40 and the Italian mutant E22K (H-6698) showed no effect.

Catalog Number: H-6696.0500BA

Supplier: Bachem Americas

SDS Sale

Clearance

Ethoxyacetylene 40% (w/w) in hexanes

Description: Ethoxyacetylene 40% (w/w) in hexanes

Catalog Number: TS30739-0010

Supplier: Thermo Scientific Chemicals

Sale

Clearance

Sodium borohydride 12% in sodium hydroxide solution 40%

Description: Sodium borohydride 12% in sodium hydroxide solution 40%

Catalog Number: TS389932500

Supplier: Thermo Scientific Chemicals

New Product Sale

Clearance

Glyoxal 40% in water

Description: Glyoxal, 40 Percent in Water is used as a crosslinker for starch-based products in the coated paper and textile industry, as well as, being used as a solubilizer and crosslinker in polymer chemistry

Catalog Number: 700003-704

Supplier: Spectrum Chemicals

Certificates Sale

Clearance

Human Beta-Amyloid (11-40)

Description: Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103005-822

Supplier: Anaspec Inc

Sale