You Searched For: gastroin

Supplier: Diagnostic Biosystems

Description: MOC-31 antibody recognizes an epithelial-associated, glycoprotein located on the cell membrane surface and in the cytoplasm of virtually all epithelial cells. It is not present in most squamous epithelia, hepatocytes, renal proximal tubular cells, gastric parietal cells and myoepithelial cells. MOC-31 may be used in a panel of antibodies as a negative marker for mesothelioma, or lung adenocarcinoma. Studies have shown that MOC31 is useful in differentiating tumors of unknown origin in liver cancers and distinguishing Cholangiocarcinoma from Hepatocellular Carcinomas.

Supplier: Diagnostic Biosystems

Description: The caudal-related homeodomain protein 2, CDX-2, is a transcription factor which is expressed in the intestine and is thought to play an important role in the proliferation and differentiation of intestinal epithelial cells. The CDX-2 protein is expressed in primary and metastatic colorectal carcinomas, intestinal metaplasia of the stomach and intestinal type gastric cancer. In human colorectal cancer, the expression of both CDX2 and carbonic anhydrase 1, a gene regulated by CDX2, is reduced or absent. CDX-2 is one of the important regulators in defining pathways for coordinate control of drug metabolism in the gastrointestinal tract.

Catalog Number: (10797-100)

Supplier: Prosci

Description: Cadherin-6 (CDH6) is also known as Kidney cadherin (K-cadherin or KCAD), is a a type II classical cadherin from the cadherin superfamily. Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH6 / KCAD contains five cadherin domains. CDH6 is highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression and also expressed in certain liver and kidney carcinomas.

Supplier: Diagnostic Biosystems

Description: The caudal-related homeodomain protein 2, CDX-2, is a transcription factor which is expressed in the intestine and is thought to play an important role in the proliferation and differentiation of intestinal epithelial cells. The CDX-2 protein is expressed in primary and metastatic colorectal carcinomas, intestinal metaplasia of the stomach and intestinal type gastric cancer. In human colorectal cancer, the expression of both CDX2 and carbonic anhydrase 1, a gene regulated by CDX2, is reduced or absent. CDX-2 is one of the important regulators in defining pathways for coordinate control of drug metabolism in the gastrointestinal tract.

Supplier: Peprotech

Description: EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). Recombinant Murine EGF is a 6.0 kDa globular protein containing 53 amino acid residues, including 3 intramolecular disulfide bonds. Manufactured using all Animal-Free reagents.

Catalog Number: (76173-252)

Supplier: Boster Biological Technology

Description: Polyclonal antibody for FGFR 4/FGFR4 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. FGFR 4/FGFR4 information: Molecular Weight: 87954 MW; Subcellular Localization: Cell membrane; Single-pass type I membrane protein. Endosome. Endoplasmic reticulum. Internalized from the cell membrane to recycling endosomes, and from there back to the cell membrane; Tissue Specificity: Expressed in gastrointestinal epithelial cells, pancreas, and gastric and pancreatic cancer cell lines.

Catalog Number: (75883-220)

Supplier: Biotium

Description: This antibody recognizes a glycoprotein of ~200 kDa, identified as carbonic anhydrase IX (CAIX/gp200). Carbonic Anhydrases (CAs) are members of a large family of zinc metallo-enzymes that catalyze the reversible hydration of carbon dioxide. CAs are involved in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric juice. They show extensive diversity in distribution and in their subcellular localization. CA IX is specifically expressed in clear-cell renal carcinomas.

Catalog Number: (76196-080)

Supplier: Prosci

Description: p21WAF1 is a specific inhibitor of cdk s and a tumor suppressor involved in the pathogenesis of a variety of malignancies. The expression of this gene acts as an inhibitor of the cell cycle during G1 phase and is tightly controlled by the tumor suppressor protein p53. Its expression is induced by the wild type, but not mutant, p53 suppressor protein. Normal cells generally display a rather intense nuclear p21 expression. Loss of p21 expression has been reported in many carcinomas (gastric carcinoma, non-small cell lung carcinoma, thyroid carcinoma).

Catalog Number: (103007-174)

Supplier: Anaspec Inc

Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (102996-380)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide, is labeled with biotin at the peptide N-terminus. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3524 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Biotium

Description: This antibody recognizes a glycoprotein of ~200 kDa, identified as carbonic anhydrase IX (CAIX/gp200). Carbonic Anhydrases (CAs) are members of a large family of zinc metallo-enzymes that catalyze the reversible hydration of carbon dioxide. CAs are involved in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric juice. They show extensive diversity in distribution and in their subcellular localization. CA IX is specifically expressed in clear-cell renal carcinomas.

Supplier: Biotium

Description: The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Lewis blood group antigens are carbohydrate moieties structurally integrated in mucous secretions. Lewis antigen system alterations have been described in gastric carcinoma and associated lesions. Anomalous expression of Lewis B antigen has been found in some non-secretory gastric carcinomas and colorectal cancers.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.

Supplier: Biotium

Description: Hepatocyte Paraffin 1 or HepPar1 localizes to the mitochondria of hepatocytes. It is a sensitive marker for distinguishing hepatocellular carcinomas (HCC) from other metastatic carcinomas as well as cholangio-carcinomas. HCC s occur primarily in the stomach, but they are also found in many other organs. The Hepatocyte Specific Antigen may also be a useful marker for intestinal metaplasia. Reportedly, strong expression of the Hepatocyte Specific Antigen correlates with smaller tumor size and longer patient survival. Occasionally, Hepatocyte Specific Antigen is also found in gastric carcinomas as well as in a few other non-hepatic tumors.

Supplier: Biotium

Description: This antibody recognizes a glycoprotein of ~200 kDa, identified as carbonic anhydrase IX (CAIX/gp200). Carbonic Anhydrases (CAs) are members of a large family of zinc metallo-enzymes that catalyze the reversible hydration of carbon dioxide. CAs are involved in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric juice. They show extensive diversity in distribution and in their subcellular localization. CA IX is specifically expressed in clear-cell renal carcinomas.

Catalog Number: (10271-048)

Supplier: Bioss

Description: CacyBP is a 228 amino acid protein encoded by the human gene CACYBP. CacyBP is primarily a nuclear protein that contains one CS domain and one SGS domain. CacyBP is believed to be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It most likely serves as a molecular bridge in ubiquitin E3 complexes. It also participates in the ubiquitin-mediated degradation of b-catenin. CacyBP is thought to be a potential inhibitor of cell growth and invasion in the gastric cancer cell through its effects on b-catenin protein expression and transcriptional activation of TCF/LEF.

Catalog Number: (10108-550)

Supplier: Prosci

Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.