Print…

You Searched For: Span\u00AE+40


41,831  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"41831"

Rate These Search Results

Image Unavailable-89294-590

MS MAB to ADENOVIRUS 40 & 41

Description: Mouse Monoclonal antibody to Adenovirus 40 & 41 Clone: HX9.B8 Species Reactivity: Virus Pkg Size: 1 mg
Catalog Number: 89294-590
Supplier: Genetex
Product Image-89055-580

6554 STILL, Short Path, with 24/40 Joints

Description: JACKETED 24/40 STILL BODY.
Catalog Number: 89055-580
Supplier: Ace Glass

Small Business Enterprise


Product Image-89055-586

6554 STILL, Short Path, with 24/40 Joints

Description: SHORT PATH STILL 24/40"C".
Catalog Number: 89055-586
Supplier: Ace Glass

Small Business Enterprise


Image Unavailable-103003-540

Biotin - beta - Amyloid (1 - 40) 0.5 mg

Description: Biotin - beta - Amyloid (1 - 40), Human, label: FAM, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, FAM is preferred over FITC, Storage -20 deg C, size: 0.5 mg
Catalog Number: 103003-540
Supplier: Anaspec Inc
Image Unavailable-103003-542

Biotin - beta - Amyloid (1 - 40) 0.1 mg

Description: Biotin - beta - Amyloid (1 - 40), Human, label: FAM, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, FAM is preferred over FITC, Storage -20 deg C, size: 0.1 mg
Catalog Number: 103003-542
Supplier: Anaspec Inc
Image Unavailable-TCB0448-100ML

Benzyltrimethylammonium Hydroxide (40% In Methanol)

Description: Benzyltrimethylammonium Hydroxide (40% In Methanol), Cas Number: 100-85-6, Molecular Formula: C10H17NO, Molecular Weight:  167.25, Size: 100ML, 100-85-6, C10H17NO, 167.25
Catalog Number: TCB0448-100ML
Supplier: TCI America

SDS Certificates


Image Unavailable-10252-930

HSP 40-4/HDJ2/DNAJA1 Antibody

Description: HSP 40-4/HDJ2/DNAJA1 Polyclonal Antibody, Host: Rabbit, Cy3 Conjugated, Emmission: 512, 550nm/570, 615nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DJ 2; DJ2; DjA1; DnaJ Hsp40 homolog, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10252-930
Supplier: Bioss
Image Unavailable-103010-638

AggreSure* beta-Amyloid (1-40) 0.25 mg

Description: AggreSure* beta-Amyloid (1-40), human, Peptide Purity: >90%, Molecular Weight: 4329.9, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Appearance: Lyophilized white powder, this peptide is pretreated and tested for aggregation, size: 0.25 mg
Catalog Number: 103010-638
Supplier: Anaspec Inc
Image Unavailable-103007-602

Human [Arg6]-beta-Amyloid (1-40)

Description: Human [Arg6]-beta-Amyloid (1-40)
Catalog Number: 103007-602
Supplier: Anaspec Inc
Product Image-102865-552

Spic and Span* Disinfecting All-Purpose Cleaner, Fresh Scent, 32 oz Spray Bottle, 8/CT

Catalog Number: 102865-552
Supplier: Janitorial Supplies
Image Unavailable-10252-932

HSP 40-4/HDJ2/DNAJA1 Antibody

Description: HSP 40-4/HDJ2/DNAJA1 Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DJ 2; DJ2; DjA1; DnaJ Hsp40 homolog, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10252-932
Supplier: Bioss
Product Image-76519-286

Centrifuge, Benchtop, VWR® Mega Star 4.0 general purpose 4 L benchtop centrifuge tissue culture package, ventilated, 120 V (tissue culture packages includes TX1000 rotor, set of 4×1000 ml buckets, set of four ClickSeal™ biocontainment lids, set of four 10×50 ml conical tube adapters, set of four 24×15 ml conical tube adapters), VWR®, VWR® Mega Star 4.0, Refrigerated: -, Capacity: 4.0 L

Description: Centrifuge, Benchtop, VWR® Mega Star 4.0 general purpose 4 L benchtop centrifuge tissue culture package, ventilated, 120 V (tissue culture packages includes TX1000 rotor, set of 4×1000 ml buckets, set of four ClickSeal™ biocontainment lids, set of four 10×50 ml conical tube adapters, set of four 24×15 ml conical tube adapters), VWR®, VWR® Mega Star 4.0, Refrigerated: -, Capacity: 4.0 L
Catalog Number: 76519-286
Supplier: VWR International
Image Unavailable-10252-934

HSP 40-4/HDJ2/DNAJA1 Antibody

Description: HSP 40-4/HDJ2/DNAJA1 Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DJ 2; DJ2; DjA1; DnaJ Hsp40 homolog, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10252-934
Supplier: Bioss
Image Unavailable-77663-976

Objective, 40×

Description: Objective, 40×
Catalog Number: 77663-976
Supplier: WORLD PRECISION INSTRUMENTS LLC

New Product


Image Unavailable-102999-340

Human;Mouse;Rat Beta-Amyloid (17-40)

Description: Human;Mouse;Rat Beta-Amyloid (17-40)
Catalog Number: 102999-340
Supplier: Anaspec Inc
Image Unavailable-102999-342

Human;Mouse;Rat Beta-Amyloid (17-40)

Description: Human;Mouse;Rat Beta-Amyloid (17-40)
Catalog Number: 102999-342
Supplier: Anaspec Inc
241 - 256 of 41,831