You Searched For: Span\\u00AE+40


41,903  results were found

Sort Results

List View Easy View
SearchResultCount:"41903"
Description: Human [Cys26]-beta-Amyloid (1-40)
Catalog Number: 103007-636
Supplier: Anaspec Inc


Description: Sodium borohydride 12% in sodium hydroxide solution 40%
Catalog Number: TS389930010
Supplier: Thermo Scientific Chemicals

New Product


Description: Sodium borohydride 12% in sodium hydroxide solution 40%
Catalog Number: TS389931000
Supplier: Thermo Scientific Chemicals

New Product


Description: Sodium borohydride 12% in sodium hydroxide solution 40%
Catalog Number: TS389930025
Supplier: Thermo Scientific Chemicals

New Product


Description: Sodium borohydride 12% in sodium hydroxide solution 40%
Catalog Number: TS389932500
Supplier: Thermo Scientific Chemicals

New Product


Description: Beta - Amyloid (11 - 40), Human, Purity: % Peak Area By HPLC >/= 95%, MW: 3151.7, Sequence: (One-Letter Code): EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Post-mortem Alzheimer s diseased brain specimens reveals significant levels of AB (11-40/42), Size: 1 mg
Catalog Number: 103005-822
Supplier: Anaspec Inc


Catalog Number: TS30739-0010
Supplier: Thermo Scientific Chemicals


Catalog Number: TS30739-0050
Supplier: Thermo Scientific Chemicals


Description: Stainless Steel, Nitronic 40, S21900, Ø38x19mm
Catalog Number: 77696-743
Supplier: LGC Standards

New Product


Description: Stainless Steel, Nitronic 40, S21900, Ø38x3mm
Catalog Number: 77696-744
Supplier: LGC Standards

New Product


Description: Stainless Steel, Nitronic 40, S21900, 100g
Catalog Number: 77696-742
Supplier: LGC Standards

New Product


Catalog Number: 77458-228
Supplier: TLC Standards


Catalog Number: 77458-226
Supplier: TLC Standards


Catalog Number: 77544-848
Supplier: TLC Standards


Catalog Number: 77450-554
Supplier: TLC Standards


Catalog Number: 77454-430
Supplier: TLC Standards


177 - 192 of 41,903