You Searched For: 1-Chloro-2-(4-ethoxybenzyl)benzene

Description: This is a negative control peptide containing the reversed sequence of the first two amino acids of the receptor-activating (tethered ligand) peptide SFLLRN-NH2. It shows no detectable affinity for the binding sites.
Sequence:FSLLRN-NH2
MW:747.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103005-892

Supplier: Anaspec Inc

Sale

Description: MLC-derived peptide, a protein kinase associated with apoptosis and tumor suppression.
Sequence:KKRPQRRYSNVF
MW:1578.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-984

Supplier: Anaspec Inc

Sale

Description: This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4541.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: 102998-422

Supplier: Anaspec Inc

Sale

Description: HLA-A*0201 restricted epitope from influenza virus RNA polymerase subunit, PA (46-54).
Sequence: FMYSDFHFI
MW: 1206.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 102997-140

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Catalog Number: 103010-358

Supplier: Anaspec Inc

Sale

Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-536

Supplier: Anaspec Inc

Sale

Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
Molecular Weight: 4017.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103003-044

Supplier: Anaspec Inc

Sale

Description: Thiol-reactive biotinylating reagent for proteins and other biomolecules

Catalog Number: 103003-294

Supplier: Anaspec Inc

Sale

Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-558

Supplier: Anaspec Inc

Sale

Description: 10-Acetyl-3,7-dihydroxyphenoxazine (ADHP), also called Amplex® Red and Ampliflu™ Red, is not only a sensitive and stable fluorogenic substrate for HRP but also an ultrasensitive probe for H2O2. In the presence of HRP and H2O2, ADHP generates highly fluorescent resorufin that has maximum absorption of 571 nm and maximum emission of 585 nm. Unlike other HRP substrates such as dihydrofluoresceins and dihydrorhodamines, the air-oxidation of ADHP is minimal. So far ADHP has been known as the most sensitive and stable fluorogenic probe for detecting HRP and H2O2. ADHP has been widely used to detect HRP in many immunoassays. On the other hand, Zhou, et al. have demonstrated that ADHP can be used to detect trace amount of H2O2. The ADHP-based H2O2 detection is at least one order of magnitude more sensitive than the commonly used scopoletin assay for H2O2. Because H2O2 is produced in many enzymatic redox reactions, ADHP can be used in coupled enzymatic reactions to detect the activity of many oxidases and/or related enzymes/substrates or cofactors such as glucose, acetylcholine and cholesterol, L-glutamate, amino acids, etc. We offer the best quality of ADHP with the most competitive price. The reagent can be purchased in a single 25 mg vial or can be custom-packaged to meet your special requirements.

Catalog Number: 103011-304

Supplier: Anaspec Inc

Sale

Description: In this protease substrate, collagen is heavily labeled with a fluorescein derivative, resulting in almost total quenching of the conjugate's fluorescence. Protease-catalyzed hydrolysis relieves this quenching conjugate, yielding brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity. Collagen, Type IV should be particularly useful in the development of HTS assays for screening Gelatinase A (MMP-2) and Gelatinase A inhibitors, as well as for other gelatinases and collagenases that specifically degrade (Type IV) Collagen. Additionally, lightly fluorescein-labeled collagen may be useful for continuous assays monitored by fluorescence polarization.

Catalog Number: 103011-294

Supplier: Anaspec Inc

Sale

Description: This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.
Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3369.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103003-734

Supplier: Anaspec Inc

Sale

Description: Histone deacetylase (HDAC) enzymes act as transcriptional repressors of genes through the deacetylation of lysine residues on histone proteins

Catalog Number: 103010-516

Supplier: Anaspec Inc

Sale

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102996-406

Supplier: Anaspec Inc

Sale

Description: This peptide sequence is found in residues 1 to 21 of the histone H3K9(Ac) . H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA
MW:2296.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-962

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 (1-25) with acetylation at Lys8. It is biotinylated through a C-terminal GSGSK linker. Acetylation at Lys8 is crucial to the recruitment of the SWI/SNF (switch/sucrose non-fermenting) chromatin-remodeling complex through the bromodomain-containing protein BRG1 for transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGG-K(Ac)-GLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-158

Supplier: Anaspec Inc

Sale