You Searched For: cytometer


498  results were found

Sort Results

List View Easy View
SearchResultCount:"498"
Description: FMC63 scFv Monoclonal Antibody, Avitag* (Y45), Biotinylated , Source: expressed from human 293 cells, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 25tests
Catalog Number: 103887-906
Supplier: ACROBIOSYSTEMS INC MS


Description: Readiuse/Trade Cfse 22028, It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample. Flow cytometry combined with fluorescent staining is a powerful tool to analyze heterogeneous cell populations.
Catalog Number: 76483-504
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: FMC63 scFv Monoclonal Antibody, (Y45), PE-Labeled , Source: produced via site-specific conjugation, Isotype: Mouse IgG1/kappa, Specificity: Specifically recognizes the antigen-recognition domain of FMC63 derived CARs, Application: Flow Cytometry, Size: 25tests
Catalog Number: 103889-298
Supplier: ACROBIOSYSTEMS INC MS


Description: Cfse 22022 25Mg, It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample. Flow cytometry combined with fluorescent staining is a powerful tool to analyze heterogeneous cell populations, Size: 25mg
Catalog Number: 76483-498
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial
Catalog Number: 76463-998
Supplier: Boster Biological Technology


Description: Fura Red Potassium 21047, Fura Red is a visible light-excitable fura-2 analog that offers unique possibilities for ratiometric measurement of calcium ion in single cells by microphotometry, imaging or flow cytometry when used with single excitation, green-fluorescent calcium indicators.
Catalog Number: 76483-180
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: Fura Red Am 21048, Fura Red is a visible light-excitable fura-2 analog that offers unique possibilities for ratiometric measurement of calcium ion in single cells by microphotometry, imaging or flow cytometry when used with single excitation, green-fluorescent calcium indicators.
Catalog Number: 76483-184
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: Streptavidin-CF583R, Ex/Em: 586/609 nm, photostable, deep-red fluorescent, water-soluble, Reactivity (target): Biotin, used as secondary reagents to detect biotinylated probes such as primary antibodies for flow cytometry, western blotting, and immunofluorescence staining, Size: 1mg
Catalog Number: 76458-732
Supplier: Biotium

Description: Buccutite/Trade Rap 1340, PE-Cy5 is a popular color used in flow cytometry. Its primary absorption peak is at 565 nm with emission peak at 674 nm. The filter sets of 682/33 nm and 695/40 nm are recommended for this tandem color.
Catalog Number: 76484-448
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: Buccutite/Trade Rap 1322, PE-Cy5 is a popular color used in flow cytometry. Its primary absorption peak is at 565 nm with emission peak at 674 nm. The filter sets of 682/33 nm and 695/40 nm are recommended for this tandem color.
Catalog Number: 76484-438
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: HLA-G monoclonal antibody, clone MEM-G/1, Host: Mouse, Reactivity: Human, Isotype: IgG1, Conjugate: Biotin, Immunogen: Recombinant protein corresponding to human HLA-G heavy chain, Storage Buffer: In PBS (0.2% BSA, 0.09% sodium azide), Application: Flow Cytometry, Size: 100ug
Catalog Number: 103879-320
Supplier: Abnova


Description: HLA-DR monoclonal antibody, clone MEM-12, Host: Mouse, Reactivity: Human, Isotype: IgG1, Conjugate: (PE), Immunogen: Native from thymocyte membrane, Native purified CD86 from human ARH-77 cell, Application: Flow Cytometry, Size: 100reactions
Catalog Number: 103879-340
Supplier: Abnova


Description: Cdcfda 22025 100Mg, It is widely recognized that fluorescent labeling of cells is an effective means to determine total cell numbers or how many viable cells exist in a sample. Flow cytometry combined with fluorescent staining is a powerful tool to analyze heterogeneous cell populations, Size: 100mg
Catalog Number: 76483-500
Supplier: AAT BIOQUEST INC

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Description: ITGAM monoclonal antibody, clone MEM-174, Host: Mouse, Reactivity: Human, Isotype: IgG2A, Conjugate: PE, Immunogen: Native purified ITGAM from human granulocytes, Storage Buffer: In PBS (0.2% BSA, 0.09% sodium azide), Application: Flow Cytometry, Size: 100reactions
Catalog Number: 103879-348
Supplier: Abnova


Description: Histone H2A.X/H2AFX Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG0, Alternative Names: H2AX, H2A histone family, member X, H2A.X, H2a/x, H2AX histone, Applications: ELISA, Flow Cytometry, IHC-P, WB, Size: 100ug/vial
Catalog Number: 76463-586
Supplier: Boster Biological Technology


Description: Annexin V, conjugated to Allophycocyanin (APC) can be used to detect apoptotic cells by flow cytometry, 35-36kDa calcium-dependent phospholipid-binding protein with high affinity for phosphatidylserine, Excitation/Emmission: 650/660 nm, Concentration: 5 uL/test, Size: 100 uL vial
Catalog Number: 76414-938
Supplier: Biotium