You Searched For: Polysorbate+40


17,038  results were found

SearchResultCount:"17038"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (82024-454)
Supplier: VWR International
Description: Reversible racks are designed to hold 0.2, 0.5, or 1.5 mL tubes at one time.

Catalog Number: (76237-436)
Supplier: Rockland Immunochemical
Description: Mouse Chitinase 3-like 1 - YKL-40 AccuSignal ELISA Kit


Supplier: VWR International
Description: The flasks come with uniform wall thickness which makes these flasks ideal for heating.
Supplier: VWR
Description: Boreal standard microscopes feature metal construction, a rugged student-proof design, and precision optics making them a favorite among educators.

Catalog Number: (JT4252-1)
Supplier: AVANTOR PERFORMANCE MATERIALS US
Description: Granular. 40 mesh. Lot analysis on label.

Catalog Number: (36934-164)
Supplier: VWR International
Description: Displays current, minimum, and maximum values for dew point, wet-bulb, humidity, and temperature.

Catalog Number: (103007-256)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (89072-696)
Supplier: VWR International
Description: VWR® clear Gusseted bags on a roll are made of 100% virgin Low Density Polyethylene (LDPE) resin.


Supplier: VWR International
Description: VWR® Premium Mayo Hegar Needle Holders are constructed of surgical-grade German steel.

Supplier: VWR International
Description: VWR® Pinch Clamps for glass ball and socket or O-ring joints add convenience and speed in mounting and dismantling a glass apparatus.

Catalog Number: (10807-436)
Supplier: VWR International
Description: The VWR® Premium Webster Needle Holder is constructed of surgical-grade German steel.


Catalog Number: (89026-132)
Supplier: VWR International
Description: Flexible bellows are constructed of pure, non-contaminating PTFE.


Catalog Number: (TCB0952-005G)
Supplier: TCI America
Description: CAS Number: 1585-40-6
MDL Number: MFCD00020281
Molecular Formula: C11H6O10
Molecular Weight: 298.16
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal

Catalog Number: (10033-522)
Supplier: Enzo Life Sciences
Description: From adenovirus type 40. Inactivated by 2 hours at 54°C.


Supplier: Thermo Scientific Chemicals
Description: Pentasodium diethylenetriaminepentaacetate 40% in aqueous solution tech.

Catalog Number: (76577-238)
Supplier: AFG Bioscience
Description: Mouse Heat Shock Protein 40 (HSP-40) ELISA Kit, AFG Bioscience


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
257 - 272 of 17,038
no targeter for Bottom