Print…

You Searched For: Paraffin


29,357  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"29357"

Rate These Search Results

Product Image-84000-500

Spinning Tissue Processor

Description: With 1 cassette basket, 2 paraffin baths. Charcoal enhanced fume ventilation system. Maintains up to 10 different processing programs. Spins both clockwise and counterclockwise. Spin Speed: 0, 60, or 70rpm. Diameter: 85cm. Height: 50cm opening to 70cm. 100-240V, 50/60Hz.
Catalog Number: 84000-500
Supplier: Epredia
Product Image-84000-502

Spinning Tissue Processor

Description: With 2 cassette basket, 3 paraffin baths. Charcoal enhanced fume ventilation system. Maintains up to 10 different processing programs. Spins both clockwise and counterclockwise. Spin Speed: 0, 60, or 70rpm. Diameter: 85cm. Height: 50cm opening to 70cm. 100-240V, 50/60Hz.
Catalog Number: 84000-502
Supplier: Epredia
Image Unavailable-103278-180

MCART6 Polyclonal Antibody 100 ul

Description: MCART6, Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: MQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHSRKELKTD, Synonyms: DKFZp686O1267, Application: ICC/IF, IHC, Immunohistochemistry-Paraffin, Size: 100 ul
Catalog Number: 103278-180
Supplier: Novus Biologicals
Image Unavailable-75805-970

Masson's Trichrome Stain Kit

Description: Masson's Trichrome Stain Kit, Used for the detection of collagen fibers in tissues such as skin, heart, etc. On formalin-fixed, paraffin-embedded sections, and may be used for frozen sections as well. Collagen fibers stained blue, nuclei stained black and cytoplasm
Catalog Number: 75805-970
Supplier: Polysciences Inc
Image Unavailable-75805-968

Masson's Trichrome Stain Kit

Description: Masson's Trichrome Stain Kit, Used for the detection of collagen fibers in tissues such as skin, heart, etc. On formalin-fixed, paraffin-embedded sections, and may be used for frozen sections as well. Collagen fibers stained blue, nuclei stained black and cytoplasm
Catalog Number: 75805-968
Supplier: Polysciences Inc
Image Unavailable-103006-052

Epitope Retrieval Solution 1L

Description: Epitope Retrieval Solution are intended for Heat Induced Epitope Retrieval (HIER) on formalin-fixed, paraffin-embedded tissue sections as part of an immunohistochemical procedure, pH: 9, Size: 1 L volume, sufficient to prepare 10 L of working solution
Catalog Number: 103006-052
Supplier: Leica Biosystems MS
Image Unavailable-102971-662

Epitope Retrieval Solution

Description: Epitope Retrieval Solutions pH6, intended for Heat Induced Epitope Retrieval (HIER) on formalin-fixed, paraffin-embedded tissue sections as part of an immunohistochemical procedure, improves the staining of some antibodies by exposing epitopes within tissue
Catalog Number: 102971-662
Supplier: Leica Biosystems MS
Product Image-103305-626

Tris Buffer 1000ml

Description: Tris Buffer, pH 10.0, 1x buffer solution, 10x reagent, Intended for heat-induced antigen retriever on formalin-fixed paraffin-embedded tissue sections prior to application of antibodies, Improves accessibility of antibodies to tissue antigens, Storage: 2-8 deg C, Volume: 1000ml
Catalog Number: 103305-626
Supplier: Electron Microscopy Sciences


Product Image-103303-056

Tris Buffer 100ml

Description: Tris Buffer, pH 10.0, 1x buffer solution, 10x reagent, Intended for heat-induced antigen retriever on formalin-fixed paraffin-embedded tissue sections prior to application of antibodies, Improves accessibility of antibodies to tissue antigens, Storage: 2-8 deg C, Volume: 100ml
Catalog Number: 103303-056
Supplier: Electron Microscopy Sciences


Image Unavailable-103283-014

PTCD1 Polyclonal Antibody 0.1 ml

Description: PTCD1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Synonymns: KIAA0632pentatricopeptide repeat-containing protein 1, pentatricopeptide repeat domain 1, Application: ICC/IF, Immunohistochemistry, Immunohistochemistry-Paraffin, Size: 0.1 ml
Catalog Number: 103283-014
Supplier: Novus Biologicals
Image Unavailable-103287-718

GPRIN3 Polyclonal Antibody 100 ul

Description: GPRIN3 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Synonyms: G protein-regulated inducer of neurite outgrowth 3, GPRIN family member 3, GRIN3FLJ42625, KIAA2027, Application: Immunohistochemistry, Immunohistochemistry-Paraffin, Size: 100 ul
Catalog Number: 103287-718
Supplier: Novus Biologicals
Image Unavailable-103288-012

MRRF Polyclonal Antibody 100ul

Description: MRRF Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Synonyms: mitochondrial ribosome recycling factor, mitochondrial, MTRRF, Application: WB, Immunohistochemistry, Immunohistochemistry-Paraffin, Storage: PBS (pH 7.2) at 4 degreeC, Size: 100ul
Catalog Number: 103288-012
Supplier: Novus Biologicals
Product Image-100500-586

GELATINE CAPSULE SIZE 13, 50/BX

Description: Our large size gelatin capsules are ideal for storing either delicate or small items, it is also suitable for use as an embedding mold for paraffin or paraplast, the capsules come complete with a locking ring
Catalog Number: 100500-586
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100500-588

GELATINE CAPSULE SIZE 12, 50/BX

Description: Our large size gelatin capsules are ideal for storing either delicate or small items, it is also suitable for use as an embedding mold for paraffin or paraplast, the capsules come complete with a locking ring
Catalog Number: 100500-588
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100500-592

GELATINE CAPSULE SIZE 10, 50/BX

Description: Our large size gelatin capsules are ideal for storing either delicate or small items, it is also suitable for use as an embedding mold for paraffin or paraplast, the capsules come complete with a locking ring
Catalog Number: 100500-592
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


Product Image-100500-590

GELATINE CAPSULE SIZE 11, 50/BX

Description: Our large size gelatin capsules are ideal for storing either delicate or small items, it is also suitable for use as an embedding mold for paraffin or paraplast, the capsules come complete with a locking ring
Catalog Number: 100500-590
Supplier: Electron Microscopy Sciences

Minority or Woman-Owned Business Enterprise


225 - 240 of 29,357