You Searched For: Nonidet®+P+40+Substitute+(NP-40)

24,662 results were found

Refine Results Sort by

Sort Results

List View Easy View

Compare(0) Clear

Rate These Search Results

Human [Lys22]-beta-Amyloid (1-40)

Catalog Number: (103007-214)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Retrieving Each

HEPES lysis buffer with NP-40 (2X)

Supplier: Thermo Scientific Chemicals

Description: Liquid

SDS Certificates

Human Beta-Amyloid (3-40)

Catalog Number: (103006-264)

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Retrieving Each

Manganese 99+%, powder -40 mesh

Supplier: Thermo Scientific Chemicals

Description: Manganese 99+%, powder -40 mesh

New Product

Erbium(III) perchlorate 40% (w/w) in water

Supplier: Thermo Scientific Chemicals

Description: Erbium(III) perchlorate 40% (w/w) in water

New Product

NP-40 lysis buffer (2X), Thermo Scientific

Supplier: Thermo Scientific Chemicals

Description: Liquid

SDS Certificates

Tetrabutylammonium hydroxide 40% (w/w) 1.5 M in water

Supplier: Thermo Scientific Chemicals

Description: Tetrabutylammonium hydroxide 40% (w/w) 1.5 M in water

New Product

Sand 40-100 mesh, pure

Supplier: Thermo Scientific Chemicals

Description: Sand 40-100 mesh, pure

New Product

TRC Articaine Hydrochloride

Catalog Number: (77977-785)

Supplier: LGC Standards

Description: TRC Articaine Hydrochloride

New Product

Retrieving Each

Accessories for VWR® Filter Holder, 47 mm, 40/35 Joint Connection

Supplier: VWR International

Description: Vwr* Filter Flask Graduated To 1L Capacity With 40/35 Joint

Certificates

Human Beta-Amyloid (1-40)

Supplier: Anaspec Inc

Description: Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).

VWR® Mega Star 4.0 General Purpose 4 L Benchtop Centrifuges

Supplier: VWR International

Description: Optimize projects with the Mega Star 4.0 general purpose centrifuge series. These versatile, high capacity benchtop centrifuges provide maximum sample security and reproducibility in an intuitive, easy to use platform. Choose between a ventilated or refrigerated 4.0 L model, sold as an individual centrifuge or a package, to optimize bench space and productivity.