You Searched For: Nonidet®+P+40+Substitute+(NP-40)


24,662  results were found

SearchResultCount:"24662"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Thermo Scientific Chemicals
Description: Liquid
Catalog Number: (103006-264)
Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-40) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-40). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-40) and Aß (11- 40) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4143.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Thermo Scientific Chemicals
Description: Manganese 99+%, powder -40 mesh

New Product

Supplier: Thermo Scientific Chemicals
Description: Erbium(III) perchlorate 40% (w/w) in water

New Product

Supplier: Thermo Scientific Chemicals
Description: Liquid
Supplier: Thermo Scientific Chemicals
Description: Tetrabutylammonium hydroxide 40% (w/w) 1.5 M in water

New Product

Supplier: Thermo Scientific Chemicals
Description: Sand 40-100 mesh, pure

New Product

Catalog Number: (77977-785)
Supplier: LGC Standards
Description: TRC Articaine Hydrochloride

New Product


Supplier: VWR International
Description: Vwr* Filter Flask Graduated To 1L Capacity With 40/35 Joint
Supplier: Anaspec Inc
Description: Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).

Supplier: VWR International
Description: Optimize projects with the Mega Star 4.0 general purpose centrifuge series. These versatile, high capacity benchtop centrifuges provide maximum sample security and reproducibility in an intuitive, easy to use platform. Choose between a ventilated or refrigerated 4.0 L model, sold as an individual centrifuge or a package, to optimize bench space and productivity.

Supplier: Matrix Scientific
Description: Diphenyl-2-pyridylphosphine ≥97%

Catalog Number: (TS37157-0050)
Supplier: Thermo Scientific Chemicals
Description: (Triphenylphosphoranylidene)acetonitrile 96%


Supplier: Ambeed
Description: 1-Hexylpyridinium hexafluorophosphate 98%

New Product

Supplier: TCI America
Description: 1-Butyl-1-methylpyrrolidiniumhexafluorophosphate ≥98.0% (by total nitrogen basis)

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
33 - 48 of 24,662
no targeter for Bottom