Print…

You Searched For: Nonidet®+P+40+Substitute+(NP-40)


24,671  results were found

Refine Results Sort by
SearchResultCount:"24671"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-212

Human [Gln22, Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-212)
Supplier: Anaspec Inc
Description: This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-80601-884

NP-40 Alternative, MilliporeSigma

Supplier: MilliporeSigma
Description: NP-40 alternative is a non-ionic surfactant used in the isolation and purification of functional membrane protein complexes and in two-dimensional (2D) gel electrophoresis.

Certificates

Image Unavailable-103007-600

Human [Asn7]-beta-Amyloid (1-40)

Catalog Number: (103007-600)
Supplier: Anaspec Inc
Description: Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the Tottori mutation produces beta amyloid peptides with the D7N substitution at the peptide N terminus. This was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Image Unavailable-103007-210

Human [Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-210)
Supplier: Anaspec Inc
Description: This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-AAJ60766-AK

NP-40 lysis buffer, Thermo Scientific

Supplier: Thermo Scientific Chemicals
Description: Liquid

SDS Certificates

Image Unavailable-AAJ62805-AK

NP-40 lysis buffer (2X), Thermo Scientific

Supplier: Thermo Scientific Chemicals
Description: Liquid

SDS Certificates

Image Unavailable-AAJ63867-AK

HEPES lysis buffer with NP-40 (2X)

Supplier: Thermo Scientific Chemicals
Description: Liquid

SDS Certificates

Product Image-PI28324

Pierce™ Surfact-Amps™ Detergent Solutions, Thermo Scientific

Supplier: Invitrogen
Description: Surfact-Amps™ detergents are ready-to-use, diluted solutions of purified detergent that can be used in routine and high-demand protein research methods and molecular biology techniques.

Certificates

Image Unavailable-700010-944

IGEPAL® CA-630

Supplier: Spectrum Chemicals
Description: Igepal(R) CA-630 is a nonionic surfactant finding application in household and industrial controlled foam detergents, industrial metal cleaners, floor cleaners and waterless hand cleaners.

Certificates Small Business Enterprise

Image Unavailable-AAJ60568-AK

PIPES lysis buffer with NP-40 (2X), Thermo Scientific

Catalog Number: (AAJ60568-AK)
Supplier: Thermo Scientific Chemicals
Description: Liquid

SDS Certificates


Image Unavailable-AAJ60902-AP

NP-40 lysis buffer, low salt, Thermo Scientific

Supplier: Thermo Scientific Chemicals
Description: Liquid

SDS Certificates

Image Unavailable-AAJ60143-AK

NP-40 lysis buffer with glycerol (2X), Thermo Scientific

Supplier: Thermo Scientific Chemicals
Description: Liquid

SDS Certificates

Image Unavailable-10062-184

Esophagus Lysate, ProSci

Catalog Number: (10062-184)
Supplier: Prosci
Description: Esophagus tissue lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Image Unavailable-10062-182

Duodenum Lysate, ProSci Inc

Catalog Number: (10062-182)
Supplier: Prosci
Description: Duodenum tissue lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Image Unavailable-10062-148

Brain Tumor Lysate, ProSci

Catalog Number: (10062-148)
Supplier: Prosci
Description: Brain tumor lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Image Unavailable-10062-622

Skin Tumor Lysate, ProSci

Catalog Number: (10062-622)
Supplier: Prosci
Description: Skin tumor tissue lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
17 - 32 of 24,671
no targeter for Bottom