Print…

You Searched For: Gold+tin+eutectic+alloy+(80:20+wt%)


96,564  results were found

Refine Results Sort by
SearchResultCount:"96564"

Sort Results

List View Easy View

Rate These Search Results

Product Image-102582-734

1-Hydroxybenzotriazole hydrate ≥99% (by HPLC) wetted with ca. 20% water, Powder

Supplier: Chem Impex International
Description: MDL: MFCD00065690 Cas: 123333-53-9

SDS

Product Image-JTX257-9

Polysorbate 80, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIALS US
Description: Polyoxyethylene (20) Sorbitan Monooleate

SDS Certificates

Image Unavailable-76633-892

Anti-MLH-1 Mouse Monoclonal Antibody [clone: G168-15]

Supplier: Diagnostic Biosystems
Description: The G168-15 antibody recognizes human and mouse MLH1 (80 to 85 kDa). The repair of mismatch DNA is essential to maintaining the integrity of genetic information over time. An alteration of microsatellite repeats is the result of slippage owing to strand misalignment during DNA replication and is referred to as microsatellite instability (MSI). These defects in DNA repair pathways have been related to human carcinogenesis. The importance of mismatch repair genes became apparent with the identification of the genetic basis for hereditary nonpolyposis colon cancer (HNPC). MSH-2 is involved in the initial cognition of mismatch nucleotides during the replication mismatch repair process. It is thought that after MSH2 binds to a mismatched DNA duplex it is joined by a heterodimer of MLH1 and PMSH, which together help facilitate the later steps in mismatch repair.

Image Unavailable-TCB2686-25G

1-Bromo-4-cyclohexylbenzene ≥97.0%

Supplier: TCI America
Description: CAS Number: 25109-28-8
Molecular Formula: C12H15Br
Molecular Weight: 239.16
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.29

SDS Certificates

Image Unavailable-TCA2089-25G

N4-Acetylcytosine ≥98.0% (by titrimetric analysis)

Catalog Number: (TCA2089-25G)
Supplier: TCI America
Description: CAS Number: 14631-20-0 MDL Number: MFCD00134466 Molecular Formula: C6H7N3O2 Molecular Weight: 153.14 Purity/Analysis Method: <gt/>98.0% (T) Form: Crystal Melting point (°C): 325

SDS


Product Image-77680-412

BioReady Gold Nanoshells for Conjugation, Carboxyl, NHS, and Streptavidin Surfaces, nanoComposix

Supplier: NANOCOMPOSIX, INC.
Description: Gold nanoshells for higher sensitivity conjugates, providing up to 20x increases in sensitivity.

New Product

Product Image-76440-164

QUANTIFOIL® R 1.2 Holey Carbon Films on Grids, Electron Microscopy Sciences

Supplier: ELECTRON MICROSCOPY SCIENCE
Description: QUANTIFOIL® is a carbon film for electron microscopy or low-energy electron point source microscopy.

Image Unavailable-10591-374

Accessories for ThunderBolt® Immunoassay Platform, Gold Standard Diagnostics

Supplier: Gold Standard Diagnostics

Image Unavailable-AA43458-36

Stainless steel (Fe:Cr:Ni:Mo; 67.5:17:13:2.5 wt%), powder -10+20 mesh Type 316-L

Supplier: Thermo Scientific Chemicals
Description: -10+20 mesh, Type 316-L

SDS Certificates

Image Unavailable-103006-558

Mouse mCRAMP

Catalog Number: (103006-558)
Supplier: Anaspec Inc
Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-BDH1162-4LP

ALCH, (∼20% H₂O) ≥80% Reagent alcohol (denatured with methanol and isopropanol), VWR Chemicals BDH®

Catalog Number: (BDH1162-4LP)
Supplier: VWR International
Description: Clear, colorless liquid. Denatured with 3.4–4.0% methanol and 3.6–4.4% 2-propanol. Suitable for cytology and histology.

SDS Certificates


Product Image-103306-358

Carbon Film on Thin Bar Square Grids, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences
Description: A thin film of pure carbon is deposited on the shiny side of the grid.

Image Unavailable-TCG0152-500G

Glyoxal 39% ∼8.8 mol/L in water

Supplier: TCI America
Description: CAS Number: 107-22-2
MDL Number: MFCD00006957
Molecular Formula: C2H2O2
Molecular Weight: 58.04
Form: Clear Liquid
Color: Colorless
Specific Gravity (20/20): 1.27

SDS Certificates

Product Image-76012-398

Anti-RPS12 Rabbit Polyclonal Antibody

Catalog Number: (76012-398)
Supplier: Prosci
Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S12E family of ribosomal proteins. It is located in the cytoplasm. Increased expression of this gene in colorectal cancers compared to matched normal colonic mucosa has been observed. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Image Unavailable-TCC1712-5G

4-Chloro-3-nitrobenzyl alcohol ≥98.0%

Supplier: TCI America
Description: CAS Number: 55912-20-4
MDL Number: MFCD00007086
Molecular Formula: C7H6ClNO3
Molecular Weight: 187.58
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 66

SDS

Image Unavailable-TCB1824-025G

2-Butylbenzofuran ≥99.0%

Catalog Number: (TCB1824-025G)
Supplier: TCI America
Description: CAS Number: 4265-27-4
MDL Number: MFCD00005851
Molecular Formula: C12H14O
Molecular Weight: 174.24
Purity/Analysis Method: >99.0% (GC)
Boiling point (°C): 129
Flash Point (°C): 101
Specific Gravity (20/20): 1.00

SDS


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
305 - 320 of 96,564
no targeter for Bottom