Print…

You Searched For: GRAYBAR+ELECTRIC+CO+INC+CP


90,240  results were found

Refine Results Sort by
SearchResultCount:"90240"

Sort Results

List View Easy View

Rate These Search Results

Product Image-30180-032

VWR® Square/Octagonal Media Bottles, Polycarbonate

Catalog Number: (30180-032)
Supplier: VWR International
Description: VWR® polycarbonate resin is an amorphous engineering thermoplastic, characterized by outstanding mechanical, optical, electrical, and thermal properties.

Certificates


Product Image-470127-430

Color LEDs

Supplier: Avantor
Description: Every color of the rainbow available!

Product Image-76637-062

Dual-Coded Sample Storage Tubes, 0.9 ml, 96-format, External Thread, Azenta Life Sciences

Supplier: AZENTA US, INC
Description: Azenta Life Sciences dual-coded tubes feature a 2D-code and Human Readable Number (HRN) on the tube base, allowing compatibility with low throughput manual workflows, semi-automated workflows or fully automated workflows on integrated platforms.

Certificates

Product Image-470014-326

Fundamentals of Physics Electric Circuits

Catalog Number: (470014-326)
Supplier: Wards
Description: The Electric Circuits Kit has everything needed to investigate simple, series, and parallel circuits, Ohm’s Law, and resistivity.
Product Image-470016-700

Banana Plug Cord Sets

Supplier: Avantor
Description: Flexible Insulated Wire and Plated Spring Contacts.

Image Unavailable-100207-838

Rubidium carbonate ≥99% (Rb basis)

Supplier: Strem Chemicals Inc
Description: CAS #: 584-09-8. Size: 50g.

Image Unavailable-100207-226

Lithium carbonate ≥99.999% (Li basis), PURATREM

Supplier: Strem Chemicals Inc
Description: CAS #: 554-13-2. Size: 25g.

Image Unavailable-100211-254

Strontium carbonate ≥99.9% (Sr basis) (low alkali and heavy metals)

Supplier: Strem Chemicals Inc
Description: CAS #: 1633-05-2. Size: 250g.

Image Unavailable-100207-240

Potassium carbonate ≥99.997% (K basis), PURATREM

Supplier: Strem Chemicals Inc
Description: CAS #: 584-08-7. Size: 10g.

Image Unavailable-470151-648

Integra Permanent Chisel Markers, Eaton Office Supply

Catalog Number: (470151-648)
Supplier: W. B. MASON CO INC. MO
Description: Permanent ink marker.
Product Image-76795-574

VWR® One Spin Mobile Clinical Centrifuge

Catalog Number: (76795-574)
Supplier: VWR International
Description: Mobile centrifuge powered directly from a vehicle’s 12 V electrical supply to provide high quality, horizontal processing for mobile phlebotomists.
Image Unavailable-102996-312

Human Pancreatic Polypeptide, AnaSpec

Supplier: Anaspec Inc
Description: Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Product Image-10217-230

Drum Pumps for Combustible Liquids, Bürkle

Supplier: BURKLE INC
Description: Drum Pumps for Combustible Liquids made of Stainless steel V2A (1.4301) / AISI 304 available with rigid discharge tube or flexible 1.2 m PTFE/stainless steel discharge hose with ball valve made of stainless steel

Product Image-89071-908

VWR® Reclosable Pink Anti-Static Bags

Catalog Number: (89071-908)
Supplier: VWR International
Description: This premium anti-static bag seals out both dust and moisture while controlling static electricity.
Image Unavailable-100209-398

Lithium carbonate ≥99.99% (Li basis), PURATREM

Supplier: Strem Chemicals Inc
Description: CAS #: 554-13-2. Size: 25g.

Product Image-77679-230

Co-Extruded PE/PVC Tubings

Supplier: INSTECH LABORATORIES, INC
Description: This tubing provides the best of both worlds; it has PE on the inside for compatibility and PVC on the outside to minimize kinking.

New Product

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
385 - 400 of 90,240
no targeter for Bottom