Print…

You Searched For: Amberlite\u00AE+IRN-150


14,520  results were found

Refine Results Sort by
SearchResultCount:"14520"

Sort Results

List View Easy View

Rate These Search Results

Product Image-77692-357

AM-2201 ((1-(5-Fluoropentyl)indol-3-yl)(naphthalen-1-yl)methanone) 0.1 mg/ml in Acetonitrile, LoGiCal, LGC Standards

Catalog Number: (77692-357)
Supplier: LGC Standards
Description: AM-2201 ((1-(5-Fluoropentyl)indol-3-yl)(naphthalen-1-yl)methanone) 0.1 mg/ml in Acetonitrile, LoGiCal, LGC Standards

New Product


Product Image-77461-886

Violet 660 sodium salt, CytoCalcein™ excited at 405 nm

Catalog Number: (77461-886)
Supplier: AAT BIOQUEST INC
Description: CytoCalcein™ Violet 660 is the esterase-cleaved product of CytoCalcein™ Violet 660 AM in live cells.
Product Image-ABCA_AB309561-10X9

Human D Amino Acid Oxidase Antibody Pair - BSA and Azide free

Catalog Number: (ABCA_AB309561-10X9)
Supplier: Abcam
Description: Human D Amino Acid Oxidase Antibody Pair - BSA and Azide free

New Product


Product Image-76483-478

CytoCalcein™ Violet 450 maximum excitation at 405 nm

Catalog Number: (76483-478)
Supplier: AAT BIOQUEST INC
Description: CytoCalcein™ Violet 450 is designed for labeling live cells in the same way to calcein, AM.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10789-670

HardyDisks™ AST Ampicillin, AM-10, HardyDisks™ AST, Hardy Diagnostics

Supplier: Hardy Diagnostics
Description: HardyDisk™ AST’s are impregnated paper disks used for Antimicrobial Susceptibility Testing (AST).

Certificates Product available on GSA Advantage®

Product Image-10063-408

Accessories for EVA PAPRs (Powered Air Purifying Respirators) Bullard®

Catalog Number: (10063-408)
Supplier: Bullard
Description: Powered Air-Purifying Respirator with AM-FM-MA-AG-HE Filter Cartridges for ammonia, formaldehyde, methylamine, chlorine, hydrogen chloride, sulfur dioxide, chlorine dioxide, hydrogen fluoride and particulates
Image Unavailable-103003-156

Human Adrenomedullin (22-52)

Catalog Number: (103003-156)
Supplier: Anaspec Inc
Description: AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-77668-082

Staurosporine 98%

Supplier: Ambeed
Description: Staurosporine 98%

New Product

Product Image-76493-214

Primaide™ HPLC System, Hitachi

Supplier: HITACHI HIGH-TECH AMERICA, INC.
Description: The Primaide™ is a standard HPLC system designed and manufactured to the highest quality by Hitachi. Suitable for academic and other small laboratories that need a sturdy and reliable standard HPLC system.

Product Image-10685-248

Anti-Macrophage surface antigen Mouse Monoclonal Antibody [clone: AM-3K]

Catalog Number: (10685-248)
Supplier: Abnova
Description: Mouse monoclonal antibody raised against macrophage surface antigen.
Image Unavailable-H-3192.0005BA

(d(CH₂)₅¹,D-Tyr(Et)²,Val⁴,Arg⁸,des-Gly⁹)-Vasopressin

Supplier: Bachem Americas
Description: For desmopressin see H-7675.

Product Image-94001-068

Tile-Top AM Anti-Fatigue Mat with Anti-Microbial Sponge, Wearwell®

Supplier: Wearwell
Description: Combats fatigue while providing a top to bottom anti-microbial solution.

Product Image-BDH7388-2

Bromocresol green-methyl red in alcohol analytical reagent, VWR Chemicals BDH®

Catalog Number: (BDH7388-2)
Supplier: VWR International
Description: Bromocresol green and methyl red in denatured alcohol (SDA-3A).

SDS Certificates


Product Image-77990-379

TRC N-Nitroso-N,N-di-(7-methyloctyl)amine

Catalog Number: (77990-379)
Supplier: LGC Standards
Description: TRC N-Nitroso-N,N-di-(7-methyloctyl)amine

New Product


Product Image-76482-990

Pluronic® F-127 10% in water

Catalog Number: (76482-990)
Supplier: AAT BIOQUEST INC
Description: Pluronic® F-127 is a nonionic surfactant that is 100% active and relatively non-toxic to cells, and frequently used with dye AM esters to improve their water solubility.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-76644-598

X-Plore® 8000 PAPR Sets

Catalog Number: (76644-598)
Supplier: Draeger
Description: An assortment of hood/helmet PAPR kits.

Environmentally Preferable


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
417 - 432 of 14,520
no targeter for Bottom