You Searched For: Anaspec Inc

Catalog Number: (103006-994)

Supplier: Anaspec Inc

Description: This β-Amyloid peptide 13 to 27 amino acid residues was used to study the kinetics of β-amyloid formation.
Sequence: HHQKLVFFAEDVGSNK
Molecular Weight: 1856.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103003-288)

Supplier: Anaspec Inc

Description: More polar than biotin; used for cell tracing

Catalog Number: (103010-278)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-2 (72-kDa gelatinase-A) is involved in tumor development and metastasis. It is proposed as a therapeutic target for cancer.

Recombinant human MMP-2 was expressed as a pro-enzyme from its DNA sequence, transfected into CHO cells. The pro-MMP-2 can be fully activated by incubating with 1 mM APMA at 37°C for 20 min to 1 hr.Its activity can be measured in FRET-based enzymatic assays. 10-20 ng of enzyme is sufficient for FRET-based assay.

Catalog Number: (103009-508)

Supplier: Anaspec Inc

Description: This is histone H3 (1-21) with deimination of Arg2, Arg8, and Arg17 to Citrulline (Cit). Its C-terminal is biotinylated through a GGK linker and blocked by an amide group. Deimination by peptidyl arginine deiminase 4 (PADI4) prevents methylation at these sites and blocks transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:A-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLA-GGK(Biotin)-NH2
MW:2725.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-752)

Supplier: Anaspec Inc

Description: This peptide is amino acid residue 149 to 157 of chemerin, a natural ligand of ChemR23, a G protein-coupled receptor expressed in immature dendritic cells and macrophages. This peptide retains most of the activities of the full size protein including ligand binding to chemerin receptor. It is a chemoattractant factor for human immature dendritic cells (DCs), macrophages, and NK cells, and play a role in skin inflammatory processes.
Sequence:YFPGQFAFS
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-444)

Supplier: Anaspec Inc

Description: The AnaTag™ APC Labeling Kit is optimized for use in the conjugation of allophycocyanin (APC) to antibodies. APC is an ultra-sensitive, near-infrared fluorescent tracer with a high quantum yield (Ex/Em = 650 nm/660 nm). APC- labeled antibodies are used in applications such as flow cytometry and immunofluorescence. The AnaTagTM APC Labeling Kit contains SH-reactive APC. SMCC modified allophycocyanin reacts with the thiol groups of target antibody without the need for additional activation, thus simplifying the conjugation protocol. AnaTagTM APC Labeling Kit contains a chemically cross-linked APC (CL-APC) that is much more stable than the native APC, but still retains the original spectroscopic properties. The amount of APC supplied in this kit is sufficient for labeling up to 1 mg of antibody. The kit provides all reagents, purification columns and a detailed step-by-step protocol. Cross-linked and SMCC-activated APC are also available as separate products.

Catalog Number: (103008-978)

Supplier: Anaspec Inc

Description: The SensoLyte® 520 Acetylcholinesterase Assay Kit is a homogeneous assay that can be used to detect the activity of enzyme and for screening of AChE inhibitors

Catalog Number: (103007-306)

Supplier: Anaspec Inc

Description: This is fibronectin derived, integrin-binding peptide. It may be used for PEG hydrogel preparation.
Sequence:Ac-GCGYGRGDSPG-NH2
MW:1066.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-178)

Supplier: Anaspec Inc

Description: The SensoLyte® 520 HIV Assay Kit uses a new FRET peptide substrate that incorporates HiLyte™ Fluor 488 (fluorophore) and QXL® 520 (quencher) for continuous measurement of enzyme activities. In the intact FRET peptide, the fluorescence of HiLyte™ Fluor 488 is quenched by QXL® 520. Upon cleavage of the FRET peptide by HIV protease, the fluorescence of HiLyte™ Fluor 488 is recovered and can be continuously monitored at excitation/emission = 490 nm/520 nm. With superior fluorescence quantum yield and longer emission wavelength, this HiLyte™ Fluor 488/QXL® 520-based FRET peptide shows less interference from autofluorescence of test compounds and cellular components, thus providing better assay sensitivity. The assays are performed in a convenient 96-well or 384-well microplate format.

Supplier: Anaspec Inc

Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (102996-882)

Supplier: Anaspec Inc

Description: The peptide sequence, ERMRPRKRQGSVRRRV (cat# 27183-1), corresponds to pseudosubstrate region of the ε-isotype of protein kinase C (PKCε) with an alanine to serine substitution. PKCε exhibits an apparent specificity for the native peptide (Km = 68 µM).
Sequence:ERMRPRKRQGSVRRRV
MW:2067.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-082)

Supplier: Anaspec Inc

Description: Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-696)

Supplier: Anaspec Inc

Description: VIP (1−12), vasoactive intestinal peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry
Sequence:HSDAVFTDNYTR
MW:1425.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103003-714)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4757.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103005-926)

Supplier: Anaspec Inc

Description: Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage.
This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.
Sequence:Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
MW:1644.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-268)

Supplier: Anaspec Inc

Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:RQIKIWFQNRRMKWKK
MW:2246.8 Da
% peak area by HPLC:95
Storage condition:-20° C