Print…

You Searched For: Closed+Circulator+Systems


68,820  results were found

Refine Results Sort by
SearchResultCount:"68820"

Sort Results

List View Easy View

Rate These Search Results

Product Image-89012-494

Mobile Laboratory Animal Anesthesia Systems, VetEquip®

Supplier: Vetequip
Description: Complete systems are suitable for mice, rats, hamsters, gerbils, guinea pigs, ferrets, rabbits, cats, dogs, or small swine. Systems can be connected to in-house evacuation, fume hood, or disposable charcoal filter.

Image Unavailable-103265-538

Anti-GFAP Mouse Monoclonal Antibody [clone: SB61a]

Catalog Number: (103265-538)
Supplier: Southern Biotechnology
Description: Glial fibrillary acid protein (GFAP) is a member of the type III intermediate filament family of proteins. GFAP is heavily expressed in astrocytes and certain other astroglia in the central nervous system, in satellite cells in peripheral ganglia, and in non-myelinating Schwann cells in peripheral nerves. It is closely related to its non-epithelial family members, vimentin, desmin, and peripherin, which are all involved in the structure and functions of the cell’s cytoskeleton. GFAP is thought to help to maintain astrocyte mechanical strength, as well as the shape of cell; however, its precise function remains poorly understood. In adults, GFAP levels increase in response to the proliferation of astrocytes associated with Alzheimer’s disease, epilepsy, and multiple sclerosis. Antibodies specific for GFAP are useful as markers of astrocytic cells and neural stem cells as well as for distinguishing neoplasms of astrocytic origin from other neoplasms in the central nervous system.
Product Image-PAV6283

CDK9/CyclinK Kinase Enzyme System, Promega

Supplier: Promega Corporation
Description: Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase (CDK) family.

Image Unavailable-10248-856

Anti-PCDH11X Rabbit Polyclonal Antibody

Catalog Number: (10248-856)
Supplier: Bioss
Description: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 7 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene is located in a major X/Y block of homology and its Y homolog, despite divergence leading to coding region changes, is the most closely related cadherin family member. The protein is thought to play a fundamental role in cell-cell recognition essential for the segmental development and function of the central nervous system. Transcripts arising from alternative splicing encode isoforms with variable cytoplasmic domains. [provided by RefSeq, Jul 2008].
Image Unavailable-102996-406

Human Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide,Biotin

Catalog Number: (102996-406)
Supplier: Anaspec Inc
Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-76008-194

Squeegees, 24" Swivel Neck Double Blade With Closed White Cell Foam Refill Cassette, Remco Products

Supplier: Remco Products
Description: The neoprene rubber blades on this squeegee are highly effective on all types of floors, as the soft rubber reaches into and cleans all spaces on the floor, such as grouting between tiles

Product Image-10750-732

Anti-ZNF536 Rabbit Polyclonal Antibody

Catalog Number: (10750-732)
Supplier: Prosci
Description: ZNF536 Antibody: ZNF536 is a recently identified zinc-finger protein that is expressed primarily in the developing nervous system and the cerebral cortex, hippocampus, and hypothalamus. ZNF536 possess ten zinc fingers and interacts with CtBP1, a corepressor for gene transcription. It is most closely related to transcriptional repressor ZNF219. Overexpression of ZNF536 in embryonic stem cells dramatically reduced the mRNA levels of neuronal marker genes such as Pax6, MAP2, and beta-tubulin III following retinoic acid (RA)-induced differentiation, while depletion of ZNF536 via RNAi resulted in elevated mRNA levels of these genes, indicating its role in inhibiting neuronal cell differentiation. Overexpression of RA receptor a rescues the inhibitory role of ZNF536, suggesting that ZNF536 might inhibit RA response element-mediated transcriptional activity.
Image Unavailable-101442-712

Anti-GFAP Mouse Monoclonal Antibody (HRP (Horseradish Peroxidase)) [clone: SB61b]

Catalog Number: (101442-712)
Supplier: Southern Biotechnology
Description: Glial fibrillary acid protein (GFAP) is a member of the type III intermediate filament family of proteins. GFAP is heavily expressed in astrocytes and certain other astroglia in the central nervous system, in satellite cells in peripheral ganglia, and in non-myelinating Schwann cells in peripheral nerves. It is closely related to its non-epithelial family members, vimentin, desmin, and peripherin, which are all involved in the structure and functions of the cell’s cytoskeleton. GFAP is thought to help to maintain astrocyte mechanical strength, as well as the shape of cell; however, its precise function remains poorly understood. In adults, GFAP levels increase in response to the proliferation of astrocytes associated with Alzheimer’s disease, epilepsy, and multiple sclerosis. Antibodies specific for GFAP are useful as markers of astrocytic cells and neural stem cells as well as for distinguishing neoplasms of astrocytic origin from other neoplasms in the central nervous system.
Product Image-89141-460

Anti-Neuropeptide Y Receptor Type 1 Rabbit Polyclonal Antibody

Catalog Number: (89141-460)
Supplier: Enzo Life Sciences
Description: Neuropeptide Y (NPY) and the closely related peptide YY (PYY) and pancreatic polypeptide (PP) are a family of 36-amino acid, tyrosine-rich peptides with amidated C-terminal ends that are known to regulate gastrointestinal and central nervous system functions including food intake and the inhibition of anxiety. Four functional NPY receptors (Y1/Y2/Y4/Y5) have been identified to date, with a fifth (y6) being a non-functional receptor in primates that is absent from the rat genome. Y1, Y2, and Y5 receptors preferentially bind NPY and PYY, while the Y4 receptor preferentially binds PP. All four receptors signal via coupling to Gi/o alpha subunits, inhibiting adenylyl cyclase activity, thereby decreasing intracellular cAMP levels. Y1 receptor deficient mice display a variety of physical and behavioral phenotypes including obesity, hyperinsulinemia, and increased territorial behavior.
Image Unavailable-76194-100

Anti-HLA-A Mouse Monoclonal Antibody [clone: CATA-1]

Catalog Number: (76194-100)
Supplier: Prosci
Description: This mAb reacts with cells bearing HLA-A25 or HLA-Aw32 antigens. In addition, a reaction was observed with a cell of phenotype A2, Aw31; B17, Bw49. HLA-A, with HLA-B and HLA-C, belongs to major histocompatibility complex (MHC) class I antigens and expresses constitutively on all nucleated cells. HLA system comprises closely linked genes controlling highly polymorphic proteins involved in the presentation of peptides to the T-cell receptor, inhibition of NK cell cytotoxicity, and rejection of tissue allotransplantation. Specific alleles at HLA loci are associated with diseases. This mAb is specifically applicable for typing peripheral T cells for the antigens HLA-A25 and HLA-Aw32.
Image Unavailable-75789-654

Human Recombinant Serpin G1 (from Cells)

Catalog Number: (75789-654)
Supplier: Prosci
Description: The Human Serpin superfamily consists of at least 35 members that target not only serine proteases, but also selected cysteine proteases and non-protease proteins. As protease inhibitors, serpins have an array of functions including regulating blood clotting, the complement pathway, extracellular matrix remodeling, and cell motility. Serpin G1 is a serine protease inhibitor protein. It is the largest member among the serpin class of proteins. Remarkably, Serpin G1 has a 2-domain structure, unlike most family members. The C-terminal serpin domain is similar to other serpins, and this part of Serpin G1 provides the inhibitory activity. The N-terminal domain is not essential for Serpin G1 to inhibit proteinases and has no similarity to other proteins. The main function of Serpin G1 is the inhibition of the complement system to prevent spontaneous activation. Serpin G1 is an acute phase protein and circulates in blood at levels of around 0.25g/L, whose levels rise 2-fold during inflammation. Although named after its complement inhibitory activity, Serpin G1 also inhibits proteinases of the fibrinolytic, clotting, and kinin pathways. Most notably, Serpin G1 play a potentially crucial role in regulating important physiological pathways including complement activation, blood coagulation, fibrinolysis and the generation of kinins. It is also the most important physiological inhibitor of fXIIa, chymotrypsin and plasma kallikrein.
Image Unavailable-77001-374

Quick-cfDNA™ Serum and Plasma Kit, Zymo Research

Catalog Number: (77001-374)
Supplier: Zymo Research
Description: Quick-cfDNA™ Serum amd Plasma kit provides a simple and reliable method for the rapid preparation of high-quality circulating cell-free DNA from serum, plasma, amniotic fluid, cerebrospinal fluid (CSF), and saliva.
Image Unavailable-10778-976

Human Recombinant Growth (from E. coli)

Supplier: Peprotech
Description: Growth Hormone (GH), also known as somatotropin, is a pleiotropic cytokine of the hematopoietic growth factor superfamily, which encompasses most cytokines, hematopoietic growth factors, and related receptors, and includes the related growth hormone receptor, prolactin, placental lactogens, proliferins, and somatolactin (SST). GH is primarily recognized for its anabolic role in stimulating the growth and differentiation of muscle, bone, and cartilage. A number of other functions, including immunomodulatory actions, are also attributed to GH, due in part to the pervasive distribution of its receptors, and the indirect effects associated with GH-stimulated production of insulin-like growth factors (IGFs). Occurring predominantly in the somatotropes of the anterior pituitary, whereupon it is stored in secretory granules, production of GH has also been noted in many other tissues, including those of the hematopoietic system. The production and pulsatile release of circulating GH is very tightly regulated by both negative and positive feedback regulations of pituitary and hypothalamic hormones, such as Pituitary-specific Positive Transcription Factor 1 (POU1F1), Growth Hormone Releasing Hormone (GHRH), and somatostatin (SRIF). Deficient production of GH is associated with dwarfism and reduction of lean body mass, while overproduction is associated with acromegaly and gigantism, as well as breast tumor growth. Recombinant Human Growth Hormone is a 22.3 kDa, single, non-glycosylated polypeptide chain containing 192 amino acid residues.

Image Unavailable-10414-006

Anti-GABBR1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10414-006)
Supplier: Bioss
Description: Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jun 2009].
Image Unavailable-10414-002

Anti-GABBR1 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10414-002)
Supplier: Bioss
Description: Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jun 2009].
Image Unavailable-H-4446.1000BA

Rat CART (55-102)

Catalog Number: (H-4446.1000BA)
Supplier: Bachem Americas
Description: CART (Cocaine- and Amphetamine-Regulated Transcript) is a recently discovered peptide, which was initially identified as mRNA produced primarily in the rat hypothalamus after administration of psychomotor stimulants. It is a satiety factor and closely associated with the actions of two important regulators of food intake, leptin and neuropeptide Y. When systemic leptin or receptors for leptin are inhibited, expression of CART mRNA is suppressed. CART (55-102) has been isolated from the hypothalamus of ovine suggesting in vivo processing at the Lys⁵³-Arg⁵⁴ region. When injected intracerebroventricularly into rats, recombinant CART peptides inhibited both normal and starvation-induced feeding, and completely blocked the feeding response induced by neuropeptide Y. Thus far, CART (55-102) appears to be the most potent fragment with a conserved secondary structure consisting of three disulfide bridges. Disruption of this secondary structure by reduction leads to a loss of the appetite induction.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
401 - 416 of 68,820
no targeter for Bottom