Print…

You Searched For: Balances+and+Scales


4,518  results were found

Refine Results Sort by
SearchResultCount:"4518"

Sort Results

List View Easy View

Rate These Search Results

Product Image-102093-202

Standard Reticles, Cross Lines with Scales, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences
Description: High quality, precision made standard reticles are manufactured to use with our microscope eyepieces. All recticles are chrome on glass and positive polarity.

Product Image-10098-924

Reaction Flask Head, 5-Neck, Scale Up Series™, Ace Glass

Supplier: Ace Glass
Description: Reaction Flasks with 5 neck flat head and flat ground Duran® flange

Small Business Enterprise

Product Image-89001-350

KIMAX® Erlenmeyer Flasks with [ST] Glass Stopper, Graduated, Kimble Chase

Supplier: DWK Life Sciences (KIMBLE)
Description: Flasks are graduated with white scale to indicate approximate volumes and have a [ST] ground glass stopper neck finish.

Certificates

Product Image-89234-812

Jet Stream®, Dust Remover, Decon Labs

Catalog Number: (89234-812)
Supplier: Decon Labs
Description: Jet Stream® High Pressure Dust Remover is moisture-free propelled air used to remove microscopic dust from negatives, microscope slides, lenses, balances and other laboratory equipment

SDS Certificates


Image Unavailable-EM1.09564.0003

pH-Indicator Paper, MilliporeSigma

Supplier: MilliporeSigma
Description: pH indicator papers supplied in rolls are better suited for longterm storage, since they are protected against external influences

SDS Certificates

Product Image-MFLX03268-88

Masterflex® Correlated Variable-Area Flowmeters, High-Flow, 65-mm Scale, Avantor®

Supplier: VWR International
Description: Don’t sacrifice suitability for precision.

Image Unavailable-16717-082

Accessories for KIMAX® Nessler Color Comparison Tubes, Tall Form, APHA Standard, Kimble Chase

Supplier: DWK Life Sciences (KIMBLE)
Description: Nessler Tubes, size 19/10 With the "Shadowless Bottom" feature. Taller and more narrow with a much longer scale length than 45310.

Certificates

Product Image-KT412510-0000

Pear-Shaped Centrifuge Tubes with Red Scale, Kimble Chase

Catalog Number: (KT412510-0000)
Supplier: DWK Life Sciences (KIMBLE)
Description: Manufactured from 33 expansion, low extractable borosilicate glass conforming to USP Type I and ASTM E438, Type I, Class A requirements and it is used in the determination of water and sediment in petroleum products.
Product Image-80074-170

Stopcocks, Straight Bore, Micro, PTFE Plugs, Chemglass

Catalog Number: (80074-170)
Supplier: Chemglass
Description: Used in the fabrication of small scale apparatus, especially apparatus that has weight restrictions. PTFE plug has a 1:5 taper.

Small Business Enterprise


Product Image-MFLX03216-55

Masterflex® Correlated Variable Area Flowmeters, PTFE Housing, 65-mm Scale, Avantor®

Supplier: VWR International
Description: Designed for high-purity applications with flexibility for a broad array of gases.

ISO9001

Product Image-10099-102

Bench Scale Jacketed Filter Reactor, Ace Glass Incorporated

Supplier: Ace Glass
Description: Jacketed filter reactor systems include all of the necessary components to perform single- or multi-step reactions and filtrations in the same vessel

Small Business Enterprise

Product Image-BDH85441.601

Test Strips, Chloride, Dosatest, VWR Chemicals BDH®

Catalog Number: (BDH85441.601)
Supplier: VWR International
Description: A ready-to-use kit that fits into your lab coat pocket.

Certificates


Product Image-76180-684

Phosphate Buffered Saline Tablets (PBS), MP Biomedical, MP Biomedicals

Supplier: MP Biomedicals
Description: Role of a balanced salt solution in cell culture is multifaceted and can be divided into four principal functions:

Certificates

Image Unavailable-AAAL05862-14

Perfluoro(methyldecalin) mixture of isomers mixture of 1- and 2-isomers (∼1:1) ≥85%, tech.

Supplier: Thermo Scientific Chemicals
Description: Trifluoromethyl(perfluorodecahydronaphthalene). Grade:tech. 85, Melting Point C-70*. Boiling Point C:159-160*. C11F20. 51294-16-7. Balance other fluorocarbons.

SDS Certificates

Image Unavailable-H-2435.0001BA

Human;Rat CRF Acetate

Supplier: Bachem Americas
Description: CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Product Image-21840-000

ACIDULATE 28 Cleaning Compound, Quip Laboratories

Supplier: Quip Laboratories
Description: Designed to penetrate and dissolve urine and mineral scale deposits, and remove animal fat and protein soils.

SDS Small Business Enterprise

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
689 - 704 of 4,518
no targeter for Bottom